RegulonDB RegulonDB 10.9: Gene Form
   

yfgH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfgI yfgH yfgG TSS_2784 TSS_2784 yfgHp10 yfgHp10

Gene      
Name: yfgH    Texpresso search in the literature
Synonym(s): ECK2501, G7316, b2505
Genome position(nucleotides): 2629792 --> 2630310 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.21
External database links:  
ASAP:
ABE-0008250
ECHOBASE:
EB3956
ECOLIHUB:
yfgH
OU-MICROARRAY:
b2505
STRING:
511145.b2505
COLOMBOS: yfgH


Product      
Name: lipoprotein YfgH
Synonym(s): YfgH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,outer membrane
Molecular weight: 17.705
Isoelectric point: 8.624
Motif(s):
 
Type Positions Sequence
1 -> 21 MMKFKKCLLPVAMLASFTLAG
73 -> 114 GALIGAVAGGVIGHNVGSGSNSGTTAGAVGGGAVGAAAGSMV
22 -> 172 CQSNADDHAADVYQTDQLNTKQETKTVNIISILPAKVAVDNSQNKRNAQAFGALIGAVAGGVIGHNVGSGSNSGTTAGAVGGGAVGAAAGSMVNDKTLVEGVSLTYKEGTKVYTSTQVGKECQFTTGLAVVITTTYNETRIQPNTKCPEKS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7316-MONOMER
ECOLIWIKI:
b2505
INTERPRO:
IPR008816
PFAM:
PF05433
PRIDE:
P65290
PROSITE:
PS51257
REFSEQ:
NP_417000
UNIPROT:
P65290


Operon      
Name: yfgHI         
Operon arrangement:
Transcription unit        Promoter
yfgHI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfgHp10 2629672 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2784 2629763 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB