RegulonDB RegulonDB 10.8: Gene Form
   

yfgI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

guaA yfgI yfgH

Gene      
Name: yfgI    Texpresso search in the literature
Synonym(s): ECK2502, G7317, b2506
Genome position(nucleotides): 2630326 --> 2630865 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.26
External database links:  
ASAP:
ABE-0008252
ECHOBASE:
EB3957
OU-MICROARRAY:
b2506
PortEco:
yfgI
STRING:
511145.b2506
COLOMBOS: yfgI


Product      
Name: nalidixic acid resistance protein YfgI
Synonym(s): YfgI, conserved protein, involved in DNA damage response
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.23
Isoelectric point: 6.561
Motif(s):
 
Type Positions Sequence
36 -> 178 GKNEEQRQHDEWVAERNREIQQEKQRRANAQAAANKRAATAAANKKARQDKLDAEASADKKRDQSYEDELRSLEIQKQKLALAKEEARVKRENEFIDQELKHKAAQTDVVQSEADANRNMTEGGRDLMKSVGKAEENKSDSWF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Skunca N., et al., 2013
External database links:  
DIP:
DIP-12040N
ECOCYC:
G7317-MONOMER
ECOLIWIKI:
b2506
INTERPRO:
IPR020231
PFAM:
PF17358
PRIDE:
P76573
PRODOM:
PD095266
REFSEQ:
NP_417001
UNIPROT:
P76573


Operon      
Name: yfgHI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Skunca N., Bosnjak M., Krisko A., Panov P., Dzeroski S., Smuc T., Supek F., 2013, Phyletic profiling with cliques of orthologs is enhanced by signatures of paralogy relationships., PLoS Comput Biol 9(1):e1002852


RegulonDB