RegulonDB RegulonDB 10.9: Gene Form
   

iscR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

iscS trmJ iscR IscR IscR Cis-reg terminator anti-terminator anti-anti-terminator TSS_2832 TSS_2832 TSS_2831 TSS_2831 iscRp iscRp TSS_2830 TSS_2830 TSS_2829 (cluster) TSS_2829 (cluster) TSS_2828 TSS_2828 TSS_2827 TSS_2827

Gene      
Name: iscR    Texpresso search in the literature
Synonym(s): ECK2528, G7326, b2531, yfhP
Genome position(nucleotides): 2661643 <-- 2662131 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.58
Reference(s): [1] Schwartz CJ., et al., 2001
External database links:  
ASAP:
ABE-0008326
ECHOBASE:
EB3178
ECOLIHUB:
iscR
OU-MICROARRAY:
b2531
STRING:
511145.b2531
COLOMBOS: iscR


Product      
Name: DNA-binding transcriptional dual regulator IscR
Synonym(s): IscR, YfhP
Sequence: Get amino acid sequence Fasta Format
Regulator Family: Rrf2
Cellular location: cytosol
Molecular weight: 17.337
Isoelectric point: 7.439
Motif(s):
 
Type Positions Sequence
92 -> 92 C
98 -> 98 C
104 -> 104 C
2 -> 131 RLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTGFLNNITLGELVN
28 -> 51 LADISERQGISLSYLEQLFSRLRK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
GO:0003700 - DNA-binding transcription factor activity
GO:0003690 - double-stranded DNA binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0042802 - identical protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
Reference(s): [1] Schwartz CJ., et al., 2001
External database links:  
DIP:
DIP-47974N
ECOCYC:
G7326-MONOMER
ECOLIWIKI:
b2531
INTERPRO:
IPR010242
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR030489
INTERPRO:
IPR000944
MODBASE:
P0AGK8
PANTHER:
PTHR33221
PDB:
4HF2
PDB:
4HF1
PDB:
4HF0
PFAM:
PF02082
PRIDE:
P0AGK8
PRODB:
PRO_000023032
PROSITE:
PS01332
PROSITE:
PS51197
REFSEQ:
NP_417026
SMR:
P0AGK8
UNIPROT:
P0AGK8


Operon      
Name: iscRSUA         
Operon arrangement:
Transcription unit        Promoter
iscRSUA


Transcriptional Regulation      
Display Regulation             
Repressed by: IscR


Regulation by small RNA    
  Display Regulation
small RNA fnrS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2827 2661124 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2828 2661560 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2829 (cluster) 2661634 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2830 2661996 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2831 2662268 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2832 2663305 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Schwartz CJ., Giel JL., Patschkowski T., Luther C., Ruzicka FJ., Beinert H., Kiley PJ., 2001, IscR, an Fe-S cluster-containing transcription factor, represses expression of Escherichia coli genes encoding Fe-S cluster assembly proteins., Proc Natl Acad Sci U S A 98(26):14895-900

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB