RegulonDB RegulonDB 10.9: Gene Form
   

yphE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yphE yphD yphF

Gene      
Name: yphE    Texpresso search in the literature
Synonym(s): ECK2544, G7341, b2547
Genome position(nucleotides): 2676850 <-- 2678361 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.08
External database links:  
ASAP:
ABE-0008376
ECHOBASE:
EB3239
ECOLIHUB:
yphE
OU-MICROARRAY:
b2547
STRING:
511145.b2547
COLOMBOS: yphE


Product      
Name: putative ABC transporter ATP-binding protein YphE
Synonym(s): YphE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.016
Isoelectric point: 5.423
Motif(s):
 
Type Positions Sequence
26 -> 178 LDNVNFTLNKGEVRALLGKNGAGKSTLIRMLTGSERPDSGDIWIGETRLEGDEATLTRRAAELGVRAVYQELSLVEGLTVAENLCLGQWPRRNGMIDYLQMAQDAQRCLQALGVDVSPEQLVSTLSPAQKQLVEIARVMKGEPRVVILDEPTS
170 -> 177 VVILDEPT
425 -> 432 ILLLDEPT
8 -> 249 VPVAKVVAGNKRYPGVVALDNVNFTLNKGEVRALLGKNGAGKSTLIRMLTGSERPDSGDIWIGETRLEGDEATLTRRAAELGVRAVYQELSLVEGLTVAENLCLGQWPRRNGMIDYLQMAQDAQRCLQALGVDVSPEQLVSTLSPAQKQLVEIARVMKGEPRVVILDEPTSSLASAEVELVISAVKKMSALGVAVIYVSHRMEEIRRIASCATVMRDGQVAGDVMLENTSTHHIVSLMLGRD
278 -> 432 LEDISFTLRRGEVLGIAGLLGAGRSELLKAIVGLEEYEQGEIVINGEKITRPDYGDMLKRGIGYTPENRKEAGIIPWLGVDENTVLTNRQKISANGVLQWSTIRRLTEEVMQRMTVKAASSETPIGTLSGGNQQKVVIGRWVYAASQILLLDEPT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-12830N
ECOCYC:
YPHE-MONOMER
ECOLIWIKI:
b2547
INTERPRO:
IPR027417
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
MODBASE:
P77509
PFAM:
PF00005
PRIDE:
P77509
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_417042
SMART:
SM00382
UNIPROT:
P77509


Operon      
Name: yphFED         
Operon arrangement:
Transcription unit        Promoter
yphFED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB