RegulonDB RegulonDB 10.9: Gene Form
   

yphG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yphG yphH yphF anti-anti-terminator anti-terminator terminator

Gene      
Name: yphG    Texpresso search in the literature
Synonym(s): ECK2546, G7343, b2549
Genome position(nucleotides): 2679464 <-- 2682745 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.88
External database links:  
ASAP:
ABE-0008380
ECHOBASE:
EB3241
ECOLIHUB:
yphG
OU-MICROARRAY:
b2549
STRING:
511145.b2549
COLOMBOS: yphG


Product      
Name: DUF5107 domain-containing protein YphG
Synonym(s): YphG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 123.832
Isoelectric point: 5.944
Motif(s):
 
Type Positions Sequence
542 -> 602 ASAYERQGQYQQAEEDFWRAVWSGNSKAGGYYGLARLAARNGNFDAGLDFCQQSLRACPTN
747 -> 776 RHLLACFYYNKRSYNKAIAFWQRCVEMSPE
39 -> 343 AVYPYGVTDTLSEQKTLKSWQAVWLENDYIKVMILPELGGRVHRAWDKVKQRDFVYHNEVIKPALVGLLGPWISGGIEFNWPQHHRPTTFMPVDFTLEAHEDGAQTVWVGETEPMHGLQVMTGFTLRPDRAALEIASRVYNGNATPRHFLWWANPAVKGGEGHQSVFPPDVTAVFDHGKRAVSAFPIATGTYYKVDYSAGVDISRYKNVPVPTSYMAEKSQYDFVGAWCHDEDGGLLHVANHHIAPGKKQWSWGHSEFGQAWDKSLTDNNGPYIELMTGIFADNQPDFTWLDAYEEKRFEQYFLP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0051301 - cell division
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12832N
ECOCYC:
G7343-MONOMER
ECOLIWIKI:
b2549
INTERPRO:
IPR019734
INTERPRO:
IPR013026
INTERPRO:
IPR011990
INTERPRO:
IPR033396
MODBASE:
P76585
PFAM:
PF17128
PFAM:
PF13432
PFAM:
PF13181
PRIDE:
P76585
PROSITE:
PS50293
REFSEQ:
NP_417044
SMART:
SM00028
SMR:
P76585
UNIPROT:
P76585


Operon      
Name: yphG         
Operon arrangement:
Transcription unit        Promoter
yphG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB