RegulonDB RegulonDB 11.0: Gene Form

yfhL gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

yfhH yfhL ryfB shoB

Name: yfhL    Texpresso search in the literature
Synonym(s): ECK2560, G7346, b2562
Genome position(nucleotides): 2699663 --> 2699923
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: putative 4Fe-4S cluster-containing protein YfhL
Synonym(s): YfhL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.791
Isoelectric point: 4.635
Type Positions Sequence Comment
1 -> 29 MALLITKKCINCDMCEPECPNEAISMGDH UniProt: 4Fe-4S ferredoxin-type 1.
31 -> 65 YEINSDKCTECVGHYETPTCQKVCPIPNTIVKDPA UniProt: 4Fe-4S ferredoxin-type 2.


Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.5 - tRNA
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0002097 - tRNA wobble base modification
Note(s): Note(s): ...[more].
Reference(s): [1] Lauhon CT. 2019
External database links:  

Name: yfhL         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


 [1] Lauhon CT., 2019, Identification and Characterization of Genes Required for 5-Hydroxyuridine Synthesis in Bacillus subtilis and Escherichia coli tRNA., J Bacteriol 201(20)
