RegulonDB RegulonDB 10.8: Gene Form
   

rseC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: rseC    Texpresso search in the literature
Synonym(s): ECK2568, G7347, b2570
Genome position(nucleotides): 2707322 <-- 2707801 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.79
External database links:  
ASAP:
ABE-0008457
ECHOBASE:
EB2970
OU-MICROARRAY:
b2570
PortEco:
rseC
STRING:
511145.b2570
COLOMBOS: rseC


Product      
Name: protein RseC
Synonym(s): RseC, SoxR and sigma;E factor regulatory protein RseC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.639
Isoelectric point: 7.044
Motif(s):
 
Type Positions Sequence
73 -> 95 SLLSSALLVYMSPLVGLFLIASL
99 -> 121 LFASDVAALCGAILGGIGGFLIA
8 -> 139 VVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLVPGQKVELGIAEGSLLSSALLVYMSPLVGLFLIASLFQLLFASDVAALCGAILGGIGGFLIARGYSRKFAARAEWQPIIL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.1 - sigma factors, anti-sigmafactors
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006979 - response to oxidative stress
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Koo MS., et al., 2003
External database links:  
ECOCYC:
G7347-MONOMER
ECOLIWIKI:
b2570
INTERPRO:
IPR007359
INTERPRO:
IPR026268
PANTHER:
PTHR35867
PFAM:
PF04246
PRIDE:
P46187
PRODB:
PRO_000023879
REFSEQ:
NP_417065
UNIPROT:
P46187


Operon      
Name: rseD-rpoE-rseABC         
Operon arrangement:
Transcription unit        Promoter
rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, NtrC, GlrR, RcsB
Repressed by: CpxR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter lepBp1 2705464 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2866 2706051 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2867 2707204 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2868 (cluster) 2707211 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2869 2709043 reverse nd [RS-EPT-CBR] [3]



RegulonDB