RegulonDB RegulonDB 10.9: Gene Form
   

abpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abpB abpA yfjJ yfjM TSS_2975 TSS_2975 TSS_2974 TSS_2974 TSS_2973 TSS_2973

Gene      
Name: abpA    Texpresso search in the literature
Synonym(s): ECK2624, G7363, b2628, yfjL
Genome position(nucleotides): 2763537 <-- 2765153 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.67
External database links:  
ASAP:
ABE-0008650
ECHOBASE:
EB2990
ECOLIHUB:
yfjL
OU-MICROARRAY:
b2628
STRING:
511145.b2628
COLOMBOS: abpA


Product      
Name: CP4-57 prophage; anti-bacteriophage protein
Synonym(s): AbpA, YfjL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 62.007
Isoelectric point: 5.728
Motif(s):
 
Type Positions Sequence
294 -> 519 KHIADNVCQWLDEVFLRPKEMSDIHKLTFIEKRERLKNSVFKSLHDVSEFLGRVLLHATIRQHHESQPIPCMLYVEKAGAEKILENVHIVRRDPEGDQLWIGFSELVTDINIAVRLPEIRDQLYEDISDCIDTARKKILDIKDDNYLLRHDIDEILDGSQPFDAHLDRFTFVLFVGYDSNLLTEPETPGFEDDLEKETAVLFEKFAADLIEDSPFANLCIHVFIYP
5 -> 215 DSGGVAAKHGFLFQDCVAAYHVTRMLRDKTIRSVRCEVTDDIDIVSDGYIDFVQVKSTGKTRWNISDIVQNSKGADKKTIPCSSILHKSMQCESDLSLGRRYSIVTEEKVNKTLEYLTISPNARLDKPGRQELIDDLNKRTDNFLTDSGISVSDWIDAATWEVFSSLRELELLGIKNIRLASQDLHGVILSSETVAEDIWCRILDTVTRKG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0005515 - protein binding
GO:0000166 - nucleotide binding
biological_process GO:0051607 - defense response to virus
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Yasui R., et al., 2014
[3] Zhang D., et al., 2012
External database links:  
ECOCYC:
G7363-MONOMER
ECOLIWIKI:
b2628
INTERPRO:
IPR025382
INTERPRO:
IPR014976
PFAM:
PF08878
PFAM:
PF14130
PRIDE:
P52127
REFSEQ:
NP_417117
UNIPROT:
P52127


Operon      
Name: abpAB         
Operon arrangement:
Transcription unit        Promoter
abpAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2973 2761243 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2974 2765321 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2975 2765482 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Yasui R., Washizaki A., Furihata Y., Yonesaki T., Otsuka Y., 2014, AbpA and AbpB provide anti-phage activity in Escherichia coli., Genes Genet Syst 89(2):51-60

 [3] Zhang D., de Souza RF., Anantharaman V., Iyer LM., Aravind L., 2012, Polymorphic toxin systems: Comprehensive characterization of trafficking modes, processing, mechanisms of action, immunity and ecology using comparative genomics., Biol Direct 7:18

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB