RegulonDB RegulonDB 10.9: Gene Form
   

yfjP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjP yfjQ rnlB rnlA terminator anti-terminator anti-anti-terminator terminator anti-anti-terminator anti-terminator yfjPp6 yfjPp6 yfjPp5 yfjPp5 yfjPp8 yfjPp8 TSS_2981 TSS_2981

Gene      
Name: yfjP    Texpresso search in the literature
Synonym(s): ECK2628, G7367, b2632
Genome position(nucleotides): 2767710 --> 2768573 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.05
External database links:  
ASAP:
ABE-0008669
ECHOBASE:
EB2994
ECOLIHUB:
yfjP
ECOO157CYC:
Z1650
OU-MICROARRAY:
b2632
STRING:
511145.b2632
COLOMBOS: yfjP


Product      
Name: CP4-57 prophage; putative GTP-binding protein YfjP
Synonym(s): YfjP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.094
Isoelectric point: 7.541
Motif(s):
 
Type Positions Sequence
90 -> 93 DLPG
233 -> 233 T
43 -> 50 GKTGAGKS
48 -> 140 GKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGVGESGVRDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVI
218 -> 218 A

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
biological_process GO:0030488 - tRNA methylation
GO:0002098 - tRNA wobble uridine modification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7367-MONOMER
ECOLIWIKI:
b2632
ECOO157CYC:
Z1650-MONOMER
INTERPRO:
IPR006073
INTERPRO:
IPR027417
MODBASE:
P52131
PFAM:
PF01926
PRIDE:
P52131
REFSEQ:
YP_026173
SMR:
P52131
UNIPROT:
P52131


Operon      
Name: yfjPQ         
Operon arrangement:
Transcription unit        Promoter
yfjPQ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2981 2767514 reverse nd [RS-EPT-CBR] [1]
  promoter yfjPp8 2767540 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfjPp5 2767642 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfjPp5 2767642 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfjPp6 2767644 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB