RegulonDB RegulonDB 10.9: Gene Form
   

yfjQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjP yfjQ yfjR terminator anti-terminator anti-anti-terminator

Gene      
Name: yfjQ    Texpresso search in the literature
Synonym(s): ECK2629, G7368, b2633
Genome position(nucleotides): 2768665 --> 2769486 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.6
External database links:  
ASAP:
ABE-0008673
ECHOBASE:
EB2995
ECOLIHUB:
yfjQ
ECOO157CYC:
Z1655
OU-MICROARRAY:
b2633
STRING:
511145.b2633
COLOMBOS: yfjQ


Product      
Name: CP4-57 prophage; DUF932 domain-containing protein YfjQ
Synonym(s): YfjQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.255
Isoelectric point: 9.853
Motif(s):
 
Type Positions Sequence
37 -> 262 KHESRSERYTYIPTISLLDSLQREGFQPFFACQTRVRDPRRREHTKHMLRLRREGQITGKQVPEIILLNSHDGTSSYQMLPGMFRAVCQNGLVCGESFGEVRVPHKGDVVSQVIEGAYEVLGIFERVEEKRDAMQSLLLPPPVQQALAKAALTYRFGEDHQPVTESQILSPRRWQDESNDLWTTYQRIQENLIKGGLSGRNAKGGRTHTRAVRGIDGDVKLNRALW

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7368-MONOMER
ECOLIWIKI:
b2633
ECOO157CYC:
Z1655-MONOMER
INTERPRO:
IPR026325
PFAM:
PF06067
PRIDE:
P52132
REFSEQ:
NP_417122
UNIPROT:
P52132


Operon      
Name: yfjPQ         
Operon arrangement:
Transcription unit        Promoter
yfjPQ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB