RegulonDB RegulonDB 11.0: Gene Form

ypjK gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

yfjR yfjT yfjS ypjK

Name: ypjK    Texpresso search in the literature
Synonym(s): ECK2631, G7370, b2635
Genome position(nucleotides): 2770445 --> 2770681
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: CP4-57 prophage; uncharacterized protein YpjK
Synonym(s): CP4-57 prophage; putative inner membrane protein, YpjK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 7.703
Isoelectric point: 10.862
Type Positions Sequence Comment
46 -> 78 ASVALTPFVGVPVGIFVGIYVFAKVVRLISGKK UniProt: Uncharacterized protein YpjK.


Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  

Name: yfjR-ypjK-yfjST         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
