RegulonDB RegulonDB 10.9: Gene Form
   

ypjK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjR yfjT yfjS ypjK

Gene      
Name: ypjK    Texpresso search in the literature
Synonym(s): ECK2631, G7370, b2635
Genome position(nucleotides): 2770445 --> 2770681 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.16
External database links:  
ASAP:
ABE-0008678
ECHOBASE:
EB4122
ECOLIHUB:
ypjK
OU-MICROARRAY:
b2635
STRING:
511145.b2635
COLOMBOS: ypjK


Product      
Name: CP4-57 prophage; uncharacterized protein YpjK
Synonym(s): CP4-57 prophage; putative inner membrane protein, YpjK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.703
Isoelectric point: 10.862
Motif(s):
 
Type Positions Sequence
1 -> 45 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGA
46 -> 78 ASVALTPFVGVPVGIFVGIYVFAKVVRLISGKK

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7370-MONOMER
ECOLIWIKI:
b2635
PRIDE:
P52134
REFSEQ:
YP_026174
UNIPROT:
P52134


Operon      
Name: yfjR-ypjK-yfjST         
Operon arrangement:
Transcription unit        Promoter
yfjR-ypjK-yfjS-yfjT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB