RegulonDB RegulonDB 10.9: Gene Form
   

yfjT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjT yfjS yfjU TSS_2982 TSS_2982

Gene      
Name: yfjT    Texpresso search in the literature
Synonym(s): ECK2633, G7372, b2637
Genome position(nucleotides): 2771148 --> 2771615 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.28
External database links:  
ASAP:
ABE-0008683
ECHOBASE:
EB2998
ECOLIHUB:
yfjT
OU-MICROARRAY:
b2637
STRING:
511145.b2637
COLOMBOS: yfjT


Product      
Name: CP4-57 prophage; uncharacterized protein YfjT
Synonym(s): YfjT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.099
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
1 -> 23 MKIRSLSRFVLASTMFASFTASA
65 -> 65 H
29 -> 29 Q
24 -> 155 VPGLWQQGYGQGNAEYSVTDASGKMFTINCTGNPDQNGIYQHSVFLILAGDKTVSSHDDSTGITVVMDHKQYAIPSTLGWRNGDNAWFSFIMDIRKARQFDVYVNDQKVGSFNPDVRNAQKVLPTLADCTND
26 -> 26 G

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7372-MONOMER
ECOLIWIKI:
b2637
PRIDE:
P52135
REFSEQ:
NP_417125
UNIPROT:
P52135


Operon      
Name: yfjR-ypjK-yfjST         
Operon arrangement:
Transcription unit        Promoter
yfjR-ypjK-yfjS-yfjT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2982 2771808 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB