RegulonDB RegulonDB 10.9: Gene Form
   

yfjZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ypjF yfjZ ypjJ

Gene      
Name: yfjZ    Texpresso search in the literature
Synonym(s): ECK2642, G7380, b2645
Genome position(nucleotides): 2777115 --> 2777432 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.4
External database links:  
ASAP:
ABE-0008709
ECHOBASE:
EB3004
ECOLIHUB:
yfjZ
ECOO157CYC:
Z1220
ECOO157CYC:
Z1658
OU-MICROARRAY:
b2645
STRING:
511145.b2645
COLOMBOS: yfjZ


Product      
Name: CP4-57 prophage; putative antitoxin of the YpjF-YfjZ toxin-antitoxin system
Synonym(s): YfjZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.737
Isoelectric point: 6.491
Motif(s):
 
Type Positions Sequence
5 -> 104 TWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAVYPTQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0051495 - positive regulation of cytoskeleton organization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7380-MONOMER
ECOLIWIKI:
b2645
ECOO157CYC:
Z1220-MONOMER
ECOO157CYC:
Z1658-MONOMER
INTERPRO:
IPR009320
INTERPRO:
IPR038025
PDB:
2JN7
PDB:
2EA9
PFAM:
PF06154
PRIDE:
P52141
REFSEQ:
NP_417132
SMR:
P52141
UNIPROT:
P52141


Operon      
Name: yfjXY-ypjJ-yfjZ-ypjF         
Operon arrangement:
Transcription unit        Promoter
yfjXY-ypjJ-yfjZ-ypjF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB