RegulonDB RegulonDB 10.9: Gene Form
   

ypjF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ypjA ypjF yfjZ psaA TSS_2985 TSS_2985 TSS_2984 TSS_2984 TSS_2983 TSS_2983

Gene      
Name: ypjF    Texpresso search in the literature
Synonym(s): ECK2643, G7381, b2646
Genome position(nucleotides): 2777453 --> 2777782 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.58
External database links:  
ASAP:
ABE-0008711
ECHOBASE:
EB4032
ECOLIHUB:
ypjF
ECOO157CYC:
Z3165
OU-MICROARRAY:
b2646
STRING:
511145.b2646
COLOMBOS: ypjF


Product      
Name: CP4-57 prophage; toxin of the YpjF-YfjZ toxin-antitoxin system
Synonym(s): YpjF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.308
Isoelectric point: 7.614
Motif(s):
 
Type Positions Sequence
65 -> 65 F
1 -> 108 MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGFSWQQQSPYISVVDILRARRSTGLLKTNV

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7381-MONOMER
ECOLIWIKI:
b2646
ECOO157CYC:
Z3165-MONOMER
INTERPRO:
IPR009610
PFAM:
PF06755
PRIDE:
Q46953
REFSEQ:
NP_417133
UNIPROT:
Q46953


Operon      
Name: yfjXY-ypjJ-yfjZ-ypjF         
Operon arrangement:
Transcription unit        Promoter
yfjXY-ypjJ-yfjZ-ypjF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2983 2777835 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2984 2778839 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2985 2779236 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB