RegulonDB RegulonDB 10.9: Gene Form
   

ypjA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ypjA ypjB ypjF pinH psaA ypjAp8 ypjAp8 TSS_2985 TSS_2985 TSS_2984 TSS_2984 TSS_2983 TSS_2983

Gene      
Name: ypjA    Texpresso search in the literature
Synonym(s): ECK2644, G7382, b2647
Genome position(nucleotides): 2778146 <-- 2782726 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.2
External database links:  
ASAP:
ABE-0008713
ECHOBASE:
EB3005
ECOLIHUB:
ypjA
OU-MICROARRAY:
b2647
STRING:
511145.b2647
COLOMBOS: ypjA


Product      
Name: adhesin-like autotransporter YpjA
Synonym(s): YpjA
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,extracellular space
Molecular weight: 157.499
Isoelectric point: 5.003
Motif(s):
 
Type Positions Sequence
30 -> 1526 AFTTNVIGVVNDETVDGNQKVDERGTTNNTHIINHGQQNVHGGVSNGSLIESGGYQDIGSHNNFVGQANNTTINGGRQSIHDGGISTGTTIESGNQDVYKGGISNGTTIKGGASRVEGGSANGILIDGGSQIVKVQGHADGTTINKSGSQDVVQGSLATNTTINGGRQYVEQSTVETTTIKNGGEQRVYESRALDTTIEGGTQSLNSKSTAKNTHIYSGGTQIVDNTSTSDVIEVYSGGVLDVRGGTATNVTQHDGAILKTNTNGTTVSGTNSEGAFSIHNHVADNVLLENGGHLDINAYGSANKTIIKDKGTMSVLTNAKADATRIDNGGVMDVAGNATNTIINGGTQNINNYGIATGTNINSGTQNIKSGGKADTTIISSGSRQVVEKDGTAIGSNISAGGSLIVYTGGIAHGVNQETGSALVANTGAGTDIEGYNKLSHFTITGGEANYVVLENTGELTVVAKTSAKNTTIDTGGKLIVQKEAKTDSTRLNNGGVLEVQDGGEAKHVEQQSGGALIASTTSGTLIEGTNSYGDAFYIRNSEAKNVVLENAGSLTVVTGSRAVDTIINANGKMDVYGKDVGTVLNSAGTQTIYASATSDKANIKGGKQTVYGLATEANIESGEQIVDGGSTEKTHINGGTQTVQNYGKAINTDIVSGLQQIMANGTAEGSIINGGSQVVNEGGLAENSVLNDGGTLDVREKGSATGIQQSSQGALVATTRATRVTGTRADGVAFSIEQGAANNILLANGGVLTVESDTSSDKTQVNMGGREIVKTKATATGTTLTGGEQIVEGVANETTINDGGIQTVSANGEAIKTKINEGGTLTVNDNGKATDIVQNSGAALQTSTANGIEISGTHQYGTFSISGNLATNMLLENGGNLLVLAGTEARDSTVGKGGAMQNLGQDSATKVNSGGQYTLGRSKDEFQALARAEDLQVAGGTAIVYAGTLADASVSGATGSLSLMTPRDNVTPVKLEGAVRITDSATLTLGNGVDTTLADLTAASRGSVWLNSNNSCAGTSNCEYRVNSLLLNDGDVYLSAQTAAPATTNGIYNTLTTNELSGSGNFYLHTNVAGSRGDQLVVNNNATGNFKIFVQDTGVSPQSDDAMTLVKTGGGDASFTLGNTGGFVDLGTYEYVLKSDGNSNWNLTNDVKPNPDPIPNPKPDPKPDPKPDPNPKPDPTPDPTPTPVPEKRITPSTAAVLNMAATLPLVFDAELNSIRERLNIMKASPHNNNVWGATYNTRNNVTTDAGAGFEQTLTGMTVGIDSRNDIPEGITTLGAFMGYSHSHIGFDRGGHGSVGSYSLGGYASWEHESGFYLDGVVKLNRFKSNVAGKMSSGGAANGSYHSNGLGGHIETGMRFTDGNWNLTPYASLTGFTADNPEYHLSNGMKSKSVDTRSIYRELGATLSYNMRLGNGMEVEPWLKAAVRKEFVDDNRVKVNSDGNFVNYLSGRRGIYQAGIKASFSSTLSGHLGVGYSHSAGVESPWNAVAGVNWSF
298 -> 360 SGTNSEGAFSIHNHVADNVLLENGGHLDINAYGSANKTIIKDKGTMSVLTNAKADATRIDNGG
821 -> 872 IVEGVANETTINDGGIQTVSANGEAIKTKINEGGTLTVNDNGKATDIVQNSG
464 -> 526 EGYNKLSHFTITGGEANYVVLENTGELTVVAKTSAKNTTIDTGGKLIVQKEAKTDSTRLNNGG
1184 -> 1220 PNPDPIPNPKPDPKPDPKPDPNPKPDPTPDPTPTPVP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0005576 - extracellular region
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12834N
ECOCYC:
G7382-MONOMER
ECOLIWIKI:
b2647
INTERPRO:
IPR006315
INTERPRO:
IPR011050
INTERPRO:
IPR012332
INTERPRO:
IPR030930
INTERPRO:
IPR036709
INTERPRO:
IPR004899
INTERPRO:
IPR003991
INTERPRO:
IPR005546
MODBASE:
P52143
PFAM:
PF16168
PFAM:
PF03797
PFAM:
PF03212
PRIDE:
P52143
PRINTS:
PR01484
PROSITE:
PS51208
REFSEQ:
NP_417134
SMART:
SM00869
SMR:
P52143
UNIPROT:
P52143


Operon      
Name: ypjA         
Operon arrangement:
Transcription unit        Promoter
ypjA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2983 2777835 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2984 2778839 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2985 2779236 reverse nd [RS-EPT-CBR] [1]
  promoter ypjAp8 2782822 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB