RegulonDB RegulonDB 11.0: Gene Form

ypjB gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

ypjA ypjB ypjC pinH ypjBp ypjBp ypjAp8 ypjAp8 TSS_2985 TSS_2985 TSS_2984 TSS_2984

Name: ypjB    Texpresso search in the literature
Synonym(s): ECK2646, G7384, b2649
Genome position(nucleotides): 2783638 <-- 2784429
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: DUF5508 domain-containing protein YpjB
Synonym(s): YpjB
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 29.787
Isoelectric point: 4.393
Type Positions Sequence Comment
233 -> 263 DFDDSSSEDDPVENSPVVTSPVVSSSKSSFQ UniProt: Disordered; Sequence Annotation Type: region of interest.
243 -> 263 PVENSPVVTSPVVSSSKSSFQ UniProt: Polar residues; Sequence Annotation Type: compositionally biased region.


Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
Note(s): Note(s): ...[more].
External database links:  

Name: ypjB         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2984 2778839 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2985 2779236 reverse nd [RS-EPT-CBR] [1]
  promoter ypjAp8 2782822 reverse nd [ICWHO] [2]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
