RegulonDB RegulonDB 10.9: Gene Form
   

ypjC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ypjB ypjC b2651 ileY unknown ypjBp ypjBp

Gene      
Name: ypjC    Texpresso search in the literature
Synonym(s): ECK2647, G7385, b2650
Genome position(nucleotides): 2784529 <-- 2785011 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
32.71
External database links:  
ASAP:
ABE-0008727
ECHOBASE:
EB3292
ECOLIHUB:
ypjC
OU-MICROARRAY:
b2650
COLOMBOS: ypjC


Product      
Name: DUF5507 domain-containing protein YpjC
Synonym(s): YpjC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 18.024
Isoelectric point: 6.927
Motif(s):
 
Type Positions Sequence
1 -> 160 MLVSKSNGFNASAVLGSGSYNENKSSKHMELLAHSILKLICKEAASETYRGALETLQKMMSECIYQEGNAFVIMGAGEQLKRIKYEVGENNLKVFNVHFNNNHELVSSGEPDVICLSKQVWENLLIKLKLENNENVFSETKKLSNKNNADQFFECAKRNE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7385-MONOMER
ECOLIWIKI:
b2650
INTERPRO:
IPR020227
PFAM:
PF17612
PRIDE:
P76613
REFSEQ:
NP_417137
UNIPROT:
P76613


Operon      
Name: ypjC         
Operon arrangement:
Transcription unit        Promoter
ypjC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB