RegulonDB RegulonDB 10.9: Gene Form
   

alaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

alaE stpA ygaC Lrp Lrp Lrp alaEp11 alaEp11 alaEp alaEp alaEp1 alaEp1 stpAp3 stpAp3 stpAp2 stpAp2 stpAp1 stpAp1

Gene      
Name: alaE    Texpresso search in the literature
Synonym(s): ECK2664, G7399, b2670, ygaW
Genome position(nucleotides): 2799164 --> 2799613 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.11
External database links:  
ASAP:
ABE-0008793
ECHOBASE:
EB3297
ECOLIHUB:
ygaW
OU-MICROARRAY:
b2670
STRING:
511145.b2670
COLOMBOS: alaE


Product      
Name: L-alanine exporter
Synonym(s): AlaE, YgaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.949
Isoelectric point: 9.531
Motif(s):
 
Type Positions Sequence
46 -> 66 LVAIPVNILIAWPYGMYRDLF
5 -> 141 QSRLRHAVADTFAMVVYCSVVNMCIEVFLSGMSFEQSFYSRLVAIPVNILIAWPYGMYRDLFMRAARKVSPSGWIKNLADILAYVTFQSPVYVAILLVVGADWHQIMAAVSSNIVVSMLMGAVYGYFLDYCRRLFKV
112 -> 132 AAVSSNIVVSMLMGAVYGYFL
85 -> 105 ILAYVTFQSPVYVAILLVVGA
16 -> 36 FAMVVYCSVVNMCIEVFLSGM

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.5 - adaptations
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015299 - solute:proton antiporter activity
GO:0034639 - L-amino acid efflux transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0033554 - cellular response to stress
GO:0032973 - amino acid export across plasma membrane
GO:0015808 - L-alanine transport
GO:1902600 - proton transmembrane transport
GO:1902475 - L-alpha-amino acid transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Moen B., et al., 2009
External database links:  
ECOCYC:
G7399-MONOMER
ECOLIWIKI:
b2670
INTERPRO:
IPR010574
PFAM:
PF06610
PRIDE:
P64550
REFSEQ:
NP_417156
UNIPROT:
P64550


Operon      
Name: alaE         
Operon arrangement:
Transcription unit        Promoter
alaE


Transcriptional Regulation      
Display Regulation             
Activated by: Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter alaEp1 2799070 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter alaEp11 2799087 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Moen B., Janbu AO., Langsrud S., Langsrud O., Hobman JL., Constantinidou C., Kohler A., Rudi K., 2009, Global responses of Escherichia coli to adverse conditions determined by microarrays and FT-IR spectroscopy., Can J Microbiol 55(6):714-28

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB