RegulonDB RegulonDB 10.9: Gene Form
   

ygaZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygaY proX ygaZ mprA ygaH MprA anti-terminator anti-anti-terminator mprAp mprAp TSS_2995 TSS_2995 TSS_2994 TSS_2994 ygaZp8 ygaZp8 TSS_2993 TSS_2993

Gene      
Name: ygaZ    Texpresso search in the literature
Synonym(s): ECK2676, G7405, b2682
Genome position(nucleotides): 2809617 --> 2810354 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.85
External database links:  
ASAP:
ABE-0008829
ECHOBASE:
EB3299
ECOLIHUB:
ygaZ
OU-MICROARRAY:
b2682
STRING:
511145.b2682
COLOMBOS: ygaZ


Product      
Name: L-valine exporter, YgaZ component
Synonym(s): YgaZ, YgaZ L-valine LIV-E exporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.108
Isoelectric point: 8.492
Motif(s):
 
Type Positions Sequence
25 -> 45 IVISYIPVAFAFGLNATRLGF
110 -> 130 TALWAFGLTDEVFAAATAKLV
24 -> 165 PIVISYIPVAFAFGLNATRLGFSPLESVFFSCIIYAGASQFVITAMLAAGSSLWIAALTVMAMDVRHVLYGPSLRSRIIQRLQKSKTALWAFGLTDEVFAAATAKLVRNNRRWSENWMIGIAFSSWSSWVFGTVIGAFSGSG
64 -> 84 FVITAMLAAGSSLWIAALTVM
141 -> 161 MIGIAFSSWSSWVFGTVIGAF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015562 - efflux transmembrane transporter activity
GO:0005304 - L-valine transmembrane transporter activity
biological_process GO:1903785 - L-valine transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7405-MONOMER
ECOLIWIKI:
b2682
INTERPRO:
IPR011606
PANTHER:
PTHR34979
PFAM:
PF03591
PRIDE:
P76630
REFSEQ:
NP_417167
UNIPROT:
P76630


Operon      
Name: ygaZH         
Operon arrangement:
Transcription unit        Promoter
ygaZH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2993 2809569 forward nd [RS-EPT-CBR] [1]
  promoter ygaZp8 2809595 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2994 2809748 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2995 2809756 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB