RegulonDB RegulonDB 10.9: Gene Form
   

yqaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gshA yqaB yqaA argQ TSS_3001 TSS_3001 TSS_3000 TSS_3000 TSS_2999 TSS_2999 TSS_2998 TSS_2998 luxSp1 luxSp1

Gene      
Name: yqaA    Texpresso search in the literature
Synonym(s): ECK2684, G7407, b2689
Genome position(nucleotides): 2816512 <-- 2816940 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.42
External database links:  
ASAP:
ABE-0008847
ECHOBASE:
EB3300
ECOLIHUB:
yqaA
OU-MICROARRAY:
b2689
STRING:
511145.b2689
COLOMBOS: yqaA


Product      
Name: DedA family protein YqaA
Synonym(s): YqaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.59
Isoelectric point: 10.57
Motif(s):
 
Type Positions Sequence
26 -> 131 EVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVILGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLCLGKALRYVAVA
3 -> 23 EALSLFSLFASSFLSATLLPG
87 -> 107 VTLLLSWMPVVGDLLCLLAGW
27 -> 47 VVLVAMLLSGISHPWVLVLTA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7407-MONOMER
ECOLIWIKI:
b2689
INTERPRO:
IPR032816
PFAM:
PF09335
PRIDE:
P0ADR0
REFSEQ:
NP_417174
UNIPROT:
P0ADR0


Operon      
Name: yqaBA         
Operon arrangement:
Transcription unit        Promoter
yqaBA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2998 2815236 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2999 2815242 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3000 2816260 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3001 2816461 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB