RegulonDB RegulonDB 10.9: Gene Form
   

ygbK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ygbK    Texpresso search in the literature
Synonym(s): ECK2732, G7418, b2737
Genome position(nucleotides): 2862335 --> 2863501 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.1
External database links:  
ASAP:
ABE-0008988
ECHOBASE:
EB2908
ECOLIHUB:
ygbK
OU-MICROARRAY:
b2737
STRING:
511145.b2737
COLOMBOS: ygbK


Product      
Name: putative 3-oxo-tetronate kinase YgbK
Synonym(s): DUF1537 domain-containing protein YgbK, YgbK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 41.339
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
253 -> 386 VVLSGSCSQMTNRQVAHYRQIAPAREVDVARCLSIETLAAYAHELAEWVLGQESVLAPLVFATASTDALAAIQQQYGAQKASQAVETLFSQLAARLAAEGVTRFIVAGGETSGVVTQSLGIKGFHIGPTISPAC
4 -> 227 IGVIADDFTGATDIASFLVENGLPTVQINGVPTGKMPEAIDALVISLKTRSCPVVEATQQSLAALSWLQQQGCKQIYFKYCSTFDSTAKGNIGPVTDALMDALDTPFTVFSPALPVNGRTVYQGYLFVMNQLLAESGMRHHPVNPMTDSYLPRLVEAQSTGRCGVVSAHVFEQGVDAVRQELARLQQEGYRYAVLDALTEHHLEIQGEALRDAPLVTGGSGLAI
360 -> 363 GGET

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Zhang X., et al., 2016
External database links:  
DIP:
DIP-12112N
ECOCYC:
G7418-MONOMER
ECOLIWIKI:
b2737
INTERPRO:
IPR010737
INTERPRO:
IPR031475
INTERPRO:
IPR037051
INTERPRO:
IPR042213
MODBASE:
Q46889
PFAM:
PF17042
PFAM:
PF07005
PRIDE:
Q46889
REFSEQ:
NP_417217
SMR:
Q46889
SWISSMODEL:
Q46889
UNIPROT:
Q46889


Operon      
Name: ygbJK         
Operon arrangement:
Transcription unit        Promoter
ygbK
ygbJK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3025 2861256 reverse nd [RS-EPT-CBR] [3]
  promoter ygbIp6 2861362 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ygbIp5 2861441 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ygbLp5 2863537 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ygbLp4 2863569 forward Similarity to the consensus
Read more >
[ICWHO] [4]



RegulonDB