RegulonDB RegulonDB 10.9: Gene Form
   

yqcA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gudP truC yqcA anti-terminator terminator TSS_3089 TSS_3089 yqcAp5 yqcAp5

Gene      
Name: yqcA    Texpresso search in the literature
Synonym(s): ECK2784, G7448, b2790
Genome position(nucleotides): 2922535 <-- 2922984 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.67
External database links:  
ASAP:
ABE-0009142
ECHOBASE:
EB2962
ECOLIHUB:
yqcA
OU-MICROARRAY:
b2790
STRING:
511145.b2790
COLOMBOS: yqcA


Product      
Name: putative flavodoxin YqcA
Synonym(s): YqcA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 16.274
Isoelectric point: 3.719
Motif(s):
 
Type Positions Sequence
10 -> 15 TMYGNS
6 -> 140 IFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNFCNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPW
4 -> 145 IGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNFCNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEQWG
99 -> 101 NFC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0000166 - nucleotide binding
GO:0010181 - FMN binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48153N
ECOCYC:
G7448-MONOMER
ECOLIWIKI:
b2790
INTERPRO:
IPR029039
INTERPRO:
IPR001094
INTERPRO:
IPR008254
MODBASE:
P65367
PDB:
2M6S
PDB:
2M6R
PFAM:
PF00258
PRIDE:
P65367
PRINTS:
PR00369
PROSITE:
PS50902
REFSEQ:
NP_417270
SMR:
P65367
UNIPROT:
P65367


Operon      
Name: yqcC-truC-yqcA         
Operon arrangement:
Transcription unit        Promoter
yqcC-truC-yqcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqcAp5 2923050 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3089 2923556 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB