RegulonDB RegulonDB 10.9: Gene Form
   

tcdA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltA tcdA csdE anti-anti-terminator anti-terminator terminator TSS_3122 TSS_3122

Gene      
Name: tcdA    Texpresso search in the literature
Synonym(s): ECK2808, G7456, b2812, csdL, ygdL
Genome position(nucleotides): 2945036 <-- 2945842 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.65
External database links:  
ASAP:
ABE-0009223
ECHOBASE:
EB2893
ECOLIHUB:
csdL
OU-MICROARRAY:
b2812
STRING:
511145.b2812
COLOMBOS: tcdA


Product      
Name: tRNA threonylcarbamoyladenosine dehydratase
Synonym(s): CSD sulfur transfer protein, CsdL, TcdA, YgdL
Sequence: Get amino acid sequence Fasta Format
Cellular location: membrane
Molecular weight: 28.562
Isoelectric point: 8.668
Motif(s):
 
Type Positions Sequence
20 -> 260 YGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSDGTVCAMKATAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKM
237 -> 257 GFGAATMVTATFGFVAVSHAL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0030955 - potassium ion binding
GO:0031402 - sodium ion binding
GO:0042803 - protein homodimerization activity
GO:0061503 - tRNA threonylcarbamoyladenosine dehydratase
GO:0008641 - ubiquitin-like modifier activating enzyme activity
biological_process GO:0061504 - cyclic threonylcarbamoyladenosine biosynthetic process
External database links:  
ECOCYC:
G7456-MONOMER
ECOLIWIKI:
b2812
INTERPRO:
IPR035985
INTERPRO:
IPR000594
MODBASE:
Q46927
PDB:
4YED
PDB:
4RDI
PDB:
4RDH
PDB:
4D7A
PDB:
4D79
PFAM:
PF00899
PRIDE:
Q46927
REFSEQ:
NP_417292
SMR:
Q46927
UNIPROT:
Q46927


Operon      
Name: tcdA         
Operon arrangement:
Transcription unit        Promoter
tcdA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3122 2946548 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB