RegulonDB RegulonDB 10.8: Gene Form
   

tas gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lplT tas ygdR aas terminator anti-terminator anti-anti-terminator TSS_3135 TSS_3135 tasp4 tasp4 TSS_3134 (cluster) TSS_3134 (cluster)

Gene      
Name: tas    Texpresso search in the literature
Synonym(s): ECK2830, G7462, b2834, ygdS
Genome position(nucleotides): 2971597 --> 2972637 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.37
Reference(s): [1] Johnson JM., et al., 2001
External database links:  
ASAP:
ABE-0009298
ECHOBASE:
EB2898
OU-MICROARRAY:
b2834
PortEco:
tas
STRING:
511145.b2834
COLOMBOS: tas


Product      
Name: putative NADP(H)-dependent aldo-keto reductase Tas
Synonym(s): Tas, YgdS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.5
Isoelectric point: 6.751
Motif(s):
 
Type Positions Sequence
16 -> 337 LGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAV
234 -> 244 SCLGFGTLTGK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004033 - aldo-keto reductase (NADP) activity
biological_process GO:0055114 - oxidation-reduction process
GO:0034198 - cellular response to amino acid starvation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [2] Blank D., et al., 2014
[3] Timms AR., et al., 1998
External database links:  
DIP:
DIP-48107N
ECOCYC:
G7462-MONOMER
ECOLIWIKI:
b2834
INTERPRO:
IPR020471
INTERPRO:
IPR036812
INTERPRO:
IPR023210
MODBASE:
P0A9T4
PANTHER:
PTHR11732
PDB:
1LQA
PFAM:
PF00248
PRIDE:
P0A9T4
PRINTS:
PR00069
PRODB:
PRO_000024027
REFSEQ:
NP_417311
SMR:
P0A9T4
UNIPROT:
P0A9T4


Operon      
Name: tas         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3134 (cluster) 2971565 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter tasp4 2971569 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_3135 2971604 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Johnson JM., Ding W., Henkhaus J., Fix D., 2001, Identification of a mutation causing increased expression of the tas gene in Escherichia coli FX-11., Mutat Res 479(1-2):121-30

 [2] Blank D., Wolf L., Ackermann M., Silander OK., 2014, The predictability of molecular evolution during functional innovation., Proc Natl Acad Sci U S A 111(8):3044-9

 [3] Timms AR., Bridges BA., 1998, Reversion of the tyrosine ochre strain Escherichia coli WU3610 under starvation conditions depends on a new gene tas., Genetics 148(4):1627-35

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB