RegulonDB RegulonDB 10.9: Gene Form
   

kduI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqeF kduI kduD anti-anti-terminator anti-terminator terminator terminator kduIp5 kduIp5

Gene      
Name: kduI    Texpresso search in the literature
Synonym(s): ECK2841, G7463, b2843, yqeE
Genome position(nucleotides): 2983288 <-- 2984124 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.58
External database links:  
ASAP:
ABE-0009332
ECHOBASE:
EB2899
ECOLIHUB:
kduI
OU-MICROARRAY:
b2843
STRING:
511145.b2843
COLOMBOS: kduI


Product      
Name: 5-dehydro-4-deoxy-D-glucuronate isomerase
Synonym(s): 5-keto 4-deoxyuronate isomerase, KduI, YqeE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.076
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
32 -> 273 ADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016861 - intramolecular oxidoreductase activity, interconverting aldoses and ketoses
GO:0008270 - zinc ion binding
GO:0008697 - 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase activity
GO:0042802 - identical protein binding
biological_process GO:0019698 - D-galacturonate catabolic process
GO:0042840 - D-glucuronate catabolic process
GO:0045490 - pectin catabolic process
External database links:  
DIP:
DIP-10069N
ECOCYC:
G7463-MONOMER
ECOLIWIKI:
b2843
INTERPRO:
IPR021120
INTERPRO:
IPR011051
INTERPRO:
IPR014710
INTERPRO:
IPR027449
INTERPRO:
IPR007045
MODBASE:
Q46938
PANTHER:
PTHR38461
PDB:
1XRU
PDB:
1X8M
PFAM:
PF04962
PRIDE:
Q46938
PRODB:
PRO_000023059
REFSEQ:
NP_417320
SMR:
Q46938
SWISSMODEL:
Q46938
UNIPROT:
Q46938


Operon      
Name: kduI         
Operon arrangement:
Transcription unit        Promoter
kduI


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter kduIp5 2984194 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB