RegulonDB RegulonDB 10.9: Gene Form
   

yqeH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqeG yqeI yqeH yqeJ yqeIp5 yqeIp5 yqeIp6 yqeIp6 yqeIp7 yqeIp7 yqeIp8 yqeIp8 yqeIp1 yqeIp1 yqeHp4 yqeHp4 yqeHp5 yqeHp5

Gene      
Name: yqeH    Texpresso search in the literature
Synonym(s): ECK2844, G7466, b2846
Genome position(nucleotides): 2987536 --> 2988168 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.44
External database links:  
ASAP:
ABE-0009349
ECHOBASE:
EB2902
ECOLIHUB:
yqeH
OU-MICROARRAY:
b2846
STRING:
511145.b2846
COLOMBOS: yqeH


Product      
Name: putative LuxR family transcriptional regulator YqeH
Synonym(s): YqeH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.287
Isoelectric point: 7.38
Motif(s):
 
Type Positions Sequence
151 -> 195 TLTQMEFTIMGYMVSGYNPYQIAEVLDMDIRSIYAYKQRIEKRMG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7466-MONOMER
ECOLIWIKI:
b2846
INTERPRO:
IPR000792
INTERPRO:
IPR016032
PFAM:
PF00196
PRIDE:
Q46941
REFSEQ:
NP_417323
SMR:
Q46941
UNIPROT:
Q46941


Operon      
Name: yqeH         
Operon arrangement:
Transcription unit        Promoter
yqeH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqeHp5 2987508 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeHp4 2987513 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeIp1 2988344 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeIp8 2988415 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeIp7 2988423 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeIp6 2988431 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeIp5 2988436 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB