RegulonDB RegulonDB 10.9: Gene Form
   

ygeH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygeH ygeG ygeI CysB ygeIp8 ygeIp8 ygeIp7 ygeIp7 ygeIp6 ygeIp6 ygeHp10 ygeHp10

Gene      
Name: ygeH    Texpresso search in the literature
Synonym(s): ECK2850, G7472, b2852
Genome position(nucleotides): 2992094 --> 2993470 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
34.71
External database links:  
ASAP:
ABE-0009368
ECHOBASE:
EB2853
ECOLIHUB:
ygeH
OU-MICROARRAY:
b2852
STRING:
511145.b2852
COLOMBOS: ygeH


Product      
Name: putative transcriptional regulator YgeH
Synonym(s): YgeH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.753
Isoelectric point: 6.62
Motif(s):
 
Type Positions Sequence
372 -> 405 ASLYYYRALVHFHNEKIEEARICIDKSLQLEPRR
4 -> 103 ENKFSYHFLEGLTLTEDGILTQGNEQVYIPQKELGVLIVLLESAGHVVLKDMIIESVWKNIIVSDESLTRCIYSLRCIFEKIGYDRCIETIYRKGYRFSG
28 -> 101 EQVYIPQKELGVLIVLLESAGHVVLKDMIIESVWKNIIVSDESLTRCIYSLRCIFEKIGYDRCIETIYRKGYRF

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Huttener M., et al., 2014
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G7472-MONOMER
ECOLIWIKI:
b2852
INTERPRO:
IPR019734
INTERPRO:
IPR016032
INTERPRO:
IPR013026
INTERPRO:
IPR011990
INTERPRO:
IPR036388
INTERPRO:
IPR001867
MODBASE:
P76639
PFAM:
PF00486
PRIDE:
P76639
PROSITE:
PS51755
PROSITE:
PS50005
PROSITE:
PS50293
REFSEQ:
NP_417329
SMART:
SM00862
SMART:
SM00028
SMR:
P76639
UNIPROT:
P76639


Operon      
Name: ygeH         
Operon arrangement:
Transcription unit        Promoter
ygeH


Transcriptional Regulation      
Display Regulation             
Activated by: CysB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygeIp6 2993581 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ygeIp7 2993591 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ygeIp8 2993603 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huttener M., Dietrich M., Paytubi S., Juarez A., 2014, HilA-like regulators in Escherichia coli pathotypes: the YgeH protein from the enteroaggregative strain 042., BMC Microbiol 14:268

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB