RegulonDB RegulonDB 10.9: Gene Form
   

pbl gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD4 insD4 ygeN pbl ygeK ygeO insC4 ygeI ygeL terminator terminator

Gene      
Name: pbl    Texpresso search in the literature
Synonym(s): ECK2852, G7474, b2854, ygeJ
Type: Pseudo Gene
Genome position(nucleotides): 2993939 --> 2994441 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
34.0
External database links:  
ASAP:
ABE-0009377
ECHOBASE:
EB2855
ECOLIHUB:
pbl
OU-MICROARRAY:
b2854
COLOMBOS: pbl


Product      
Name: transglycosylase domain-containing protein Pbl
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
25 -> 158 SNSCSNEAGTMFRIEPNLIKAIALVESNLKKDSIGKNRDKNNNIKSLDYWLMQINQMHIPLLKKRGIIKDERDLLDNPCLNIKIGTEILYNHFSRCGVTWQCLGTYNAGFAMDNQKKRQQYAPKYILYIPGLMN
1 -> 24 MRSPKVKFLTIFTFCIFITKMSFA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7474-MONOMER
ECOLIWIKI:
b2854
INTERPRO:
IPR008258
INTERPRO:
IPR023346
MODBASE:
Q46790
PFAM:
PF01464
PRIDE:
Q46790
REFSEQ:
NP_417331
SMR:
Q46790
UNIPROT:
Q46790


Operon      
Name: pbl         
Operon arrangement:
Transcription unit        Promoter
pbl


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB