RegulonDB RegulonDB 10.10: Gene Form
   

yqgE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yggR gshB yqgE yqgF terminator anti-terminator TSS_3277 (cluster) TSS_3277 (cluster) TSS_3276 (cluster) TSS_3276 (cluster) yqgEp3 yqgEp3 TSS_3275 (cluster) TSS_3275 (cluster) TSS_3274 TSS_3274 TSS_3273 TSS_3273

Gene      
Name: yqgE    Texpresso search in the literature
Synonym(s): ECK2943, G7524, b2948
Genome position(nucleotides): 3092937 --> 3093500 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.06
External database links:  
ASAP:
ABE-0009669
ECHOBASE:
EB3074
ECOLIHUB:
yqgE
OU-MICROARRAY:
b2948
STRING:
511145.b2948
COLOMBOS: yqgE


Product      
Name: DUF179 domain-containing protein YqgE
Synonym(s): YqgE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.686
Isoelectric point: 5.27
Motif(s):
 
Type Positions Sequence
12 -> 174 PALQDPIFRRSVVYICEHNTNGAMGIIVNKPLENLKIEGILEKLKITPEPRDESIRLDKPVMLGGPLAEDRGFILHTPPSNFASSIRISDNTVMTTSRDVLETLGTDKQPSDVLVALGYASWEKGQLEQEILDNAWLTAPADLNILFKTPIADRWREAAKLIG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] McClung DJ., et al., 2016
External database links:  
DIP:
DIP-36005N
ECOCYC:
G7524-MONOMER
ECOLIWIKI:
b2948
INTERPRO:
IPR003774
PANTHER:
PTHR30327
PFAM:
PF02622
PRIDE:
P0A8W5
REFSEQ:
NP_417423
SMR:
P0A8W5
SWISSMODEL:
P0A8W5
UNIPROT:
P0A8W5


Operon      
Name: yqgEF         
Operon arrangement:
Transcription unit        Promoter
yqgEF


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3273 3092076 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3274 3092824 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3275 (cluster) 3092826 forward nd [RS-EPT-CBR] [2]
  promoter yqgEp3 3092884 forward nd [ICWHO] [3]
  promoter TSS_3276 (cluster) 3092900 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3277 (cluster) 3092907 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] McClung DJ., Calixto A., Mosera MN., Kumar R., Neidle EL., Elliott KT., 2016, Novel heterologous bacterial system reveals enhanced susceptibility to DNA damage mediated by yqgF, a nearly ubiquitous and often essential gene., Microbiology 162(10):1808-1821

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB