RegulonDB RegulonDB 10.10: Gene Form
   

yggS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yggR yggS yggT yggU anti-anti-terminator anti-terminator terminator TSS_3281 TSS_3281 TSS_3280 TSS_3280 TSS_3279 (cluster) TSS_3279 (cluster) TSS_3278 TSS_3278

Gene      
Name: yggS    Texpresso search in the literature
Synonym(s): ECK2946, G7527, b2951
Genome position(nucleotides): 3095098 --> 3095802 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.35
External database links:  
ASAP:
ABE-0009681
ECHOBASE:
EB2804
ECOLIHUB:
yggS
MIM:
604436
OU-MICROARRAY:
b2951
STRING:
511145.b2951
COLOMBOS: yggS


Product      
Name: PLP homeostasis protein
Synonym(s): YggS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.787
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
7 -> 229 NLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQELGVTGLEWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGAR
36 -> 36 K

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0030170 - pyridoxal phosphate binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12194N
ECOCYC:
G7527-MONOMER
ECOLIWIKI:
b2951
INTERPRO:
IPR001608
INTERPRO:
IPR011078
INTERPRO:
IPR029066
MODBASE:
P67080
PANTHER:
PTHR10146
PDB:
1W8G
PDB:
3SY1
PFAM:
PF01168
PRIDE:
P67080
PROSITE:
PS01211
REFSEQ:
NP_417426
SMR:
P67080
UNIPROT:
P67080


Operon      
Name: yggSTU-rdgB-hemW         
Operon arrangement:
Transcription unit        Promoter
rdgB-yggW
yggSTU-rdgB-hemW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3278 3095325 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3279 (cluster) 3095663 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3280 3095806 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3281 3096085 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB