RegulonDB RegulonDB 10.10: Gene Form
   

yggT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yggS rdgB yggT yggU hemW anti-anti-terminator anti-terminator terminator rdgBp rdgBp TSS_3281 TSS_3281 TSS_3280 TSS_3280 TSS_3279 (cluster) TSS_3279 (cluster) TSS_3278 TSS_3278

Gene      
Name: yggT    Texpresso search in the literature
Synonym(s): ECK2947, G7528, b2952
Genome position(nucleotides): 3095820 --> 3096386 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.32
External database links:  
ASAP:
ABE-0009685
ECHOBASE:
EB2805
ECOLIHUB:
yggT
OU-MICROARRAY:
b2952
STRING:
511145.b2952
COLOMBOS: yggT


Product      
Name: uncharacterized protein YggT
Synonym(s): YggT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 21.167
Isoelectric point: 9.823
Motif(s):
 
Type Positions Sequence
89 -> 109 IIWIAGLLILLKTIGLLIFWV
168 -> 188 GVAEVLQATGNMLLPGLWMAL
10 -> 78 TVIELYTMVLLLRIWMQWAHCDFYNPFSQFVVKVTQPIIGPLRRVIPAMGPIDSASLLVAYILSFIKAI
67 -> 87 LVAYILSFIKAIVLFKVVTFL
1 -> 21 MNTLTFLLSTVIELYTMVLLL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0071474 - cellular hyperosmotic response
Note(s): Note(s): ...[more].
Evidence: [IFC] Inferred by functional complementation
Reference(s): [1] Ito T., et al., 2009
[2] Jindal S., et al., 2019
External database links:  
ECOCYC:
G7528-MONOMER
ECOLIWIKI:
b2952
INTERPRO:
IPR003425
PANTHER:
PTHR33219
PFAM:
PF02325
PRIDE:
P64564
REFSEQ:
NP_417427
SMR:
P64564
UNIPROT:
P64564


Operon      
Name: yggSTU-rdgB-hemW         
Operon arrangement:
Transcription unit        Promoter
rdgB-yggW
yggSTU-rdgB-hemW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3278 3095325 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3279 (cluster) 3095663 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3280 3095806 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3281 3096085 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ito T., Uozumi N., Nakamura T., Takayama S., Matsuda N., Aiba H., Hemmi H., Yoshimura T., 2009, The implication of YggT of Escherichia coli in osmotic regulation., Biosci Biotechnol Biochem 73(12):2698-704

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB