RegulonDB RegulonDB 10.10: Gene Form
   

yggU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yggS rdgB yggT yggU hemW anti-anti-terminator anti-terminator terminator rdgBp rdgBp TSS_3281 TSS_3281 TSS_3280 TSS_3280 TSS_3279 (cluster) TSS_3279 (cluster) TSS_3278 TSS_3278

Gene      
Name: yggU    Texpresso search in the literature
Synonym(s): ECK2948, G7529, b2953
Genome position(nucleotides): 3096383 --> 3096673 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.77
External database links:  
ASAP:
ABE-0009690
ECHOBASE:
EB2806
ECOLIHUB:
yggU
OU-MICROARRAY:
b2953
STRING:
511145.b2953
COLOMBOS: yggU


Product      
Name: DUF167 domain-containing protein YggU
Synonym(s): YggU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.456
Isoelectric point: 10.16
Motif(s):
 
Type Positions Sequence
11 -> 81 LVLRLYIQPKASRDSIVGLHGDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7529-MONOMER
ECOLIWIKI:
b2953
INTERPRO:
IPR036591
INTERPRO:
IPR005228
INTERPRO:
IPR003746
MODBASE:
P52060
PANTHER:
PTHR13420
PDB:
1YH5
PFAM:
PF02594
PRIDE:
P52060
REFSEQ:
NP_417428
SMART:
SM01152
SMR:
P52060
SWISSMODEL:
P52060
UNIPROT:
P52060


Operon      
Name: yggSTU-rdgB-hemW         
Operon arrangement:
Transcription unit        Promoter
rdgB-yggW
yggSTU-rdgB-hemW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3278 3095325 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3279 (cluster) 3095663 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3280 3095806 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3281 3096085 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB