RegulonDB RegulonDB 10.9: Gene Form
   

hemW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hemW yggM rdgB yggU yggT rdgBp rdgBp

Gene      
Name: hemW    Texpresso search in the literature
Synonym(s): ECK2950, G7531, b2955, yggW
Genome position(nucleotides): 3097267 --> 3098403 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.21
External database links:  
ASAP:
ABE-0009694
ECHOBASE:
EB2808
ECOLIHUB:
yggW
OU-MICROARRAY:
b2955
STRING:
511145.b2955
COLOMBOS: hemW


Product      
Name: heme chaperone HemW
Synonym(s): HemW, YggW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.584
Isoelectric point: 5.41
Motif(s):
 
Type Positions Sequence
16 -> 23 CVQKCPYC
1 -> 237 MVKLPPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLNDLDNDVAYAQGREVKTIFIGGGTPSLLSGPAMQTLLDGVRARLPLAADAEITMEANPGTVEADRFVDYQRAGVNRISIGVQSFSEEKLKRLGRIHGPQEAKRAAKLASGLGLRSFNLDLMHGLPDQSLEEALGDLRQAIELNPPHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFEQGHQLLTAAGYQQYE
11 -> 176 IHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLNDLDNDVAYAQGREVKTIFIGGGTPSLLSGPAMQTLLDGVRARLPLAADAEITMEANPGTVEADRFVDYQRAGVNRISIGVQSFSEEKLKRLGRIHGPQEAKRAAKLASGLGLRSFNLDLMHGLPDQSLEEA
304 -> 364 ATDKPFEFFMNRFRLLEAAPRVEFIAYTGLCEDVIRPQLDEAIAQGYLTECADYWQITEHG
67 -> 68 GT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0004109 - coproporphyrinogen oxidase activity
GO:0020037 - heme binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006779 - porphyrin-containing compound biosynthetic process
GO:0055114 - oxidation-reduction process
External database links:  
ECOCYC:
G7531-MONOMER
ECOLIWIKI:
b2955
INTERPRO:
IPR006638
INTERPRO:
IPR004559
INTERPRO:
IPR034505
INTERPRO:
IPR007197
INTERPRO:
IPR010723
INTERPRO:
IPR023404
MODBASE:
P52062
PANTHER:
PTHR13932
PFAM:
PF04055
PFAM:
PF06969
PRIDE:
P52062
PROSITE:
PS51918
REFSEQ:
NP_417430
SMART:
SM00729
SMR:
P52062
UNIPROT:
P52062


Operon      
Name: yggSTU-rdgB-hemW         
Operon arrangement:
Transcription unit        Promoter
rdgB-yggW
yggSTU-rdgB-hemW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB