RegulonDB RegulonDB 10.10: Gene Form
   

yggX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltC mutY yggX anti-anti-terminator TSS_3294 TSS_3294 yggXp yggXp

Gene      
Name: yggX    Texpresso search in the literature
Synonym(s): ECK2957, G7532, b2962
Genome position(nucleotides): 3104093 --> 3104368 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.46
External database links:  
ASAP:
ABE-0009722
ECHOBASE:
EB2809
ECOLIHUB:
yggX
OU-MICROARRAY:
b2962
STRING:
511145.b2962
COLOMBOS: yggX


Product      
Name: putative Fe2+-trafficking protein
Synonym(s): YggX, protein that protects iron-sulfur proteins against oxidative damage
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.953
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence
2 -> 91 SRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTPEDKK
1 -> 87 MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005506 - iron ion binding
biological_process GO:0034599 - cellular response to oxidative stress
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Pomposiello PJ., et al., 2003
External database links:  
ECOCYC:
G7532-MONOMER
ECOLIWIKI:
b2962
INTERPRO:
IPR036766
INTERPRO:
IPR007457
PANTHER:
PTHR36965
PDB:
1YHD
PFAM:
PF04362
PRIDE:
P0A8P3
REFSEQ:
NP_417437
SMR:
P0A8P3
UNIPROT:
P0A8P3


Operon      
Name: mutY-yggX-mltC-nupG         
Operon arrangement:
Transcription unit        Promoter
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
yggX
yggX-mltC
yggX-mltC-nupG
nupG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3294 3104042 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pomposiello PJ., Koutsolioutsou A., Carrasco D., Demple B., 2003, SoxRS-regulated expression and genetic analysis of the yggX gene of Escherichia coli., J Bacteriol 185(22):6624-32

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB