RegulonDB RegulonDB 10.9: Gene Form
   

dkgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqhD yqhG dkgA RcsB-BglJ anti-anti-terminator anti-terminator terminator terminator yqhHp4 yqhHp4 yqhGp yqhGp TSS_3319 TSS_3319 dkgAp dkgAp yqhCp1 yqhCp1

Gene      
Name: dkgA    Texpresso search in the literature
Synonym(s): ECK3004, G7565, b3012, yqhE
Genome position(nucleotides): 3156623 --> 3157450 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.33
External database links:  
ASAP:
ABE-0009892
ECHOBASE:
EB2835
ECOLIHUB:
dkgA
OU-MICROARRAY:
b3012
STRING:
511145.b3012
COLOMBOS: dkgA


Product      
Name: methylglyoxal reductase DkgA
Synonym(s): AKR5C2, DkgA, YqhE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.11
Isoelectric point: 6.427
Motif(s):
 
Type Positions Sequence
187 -> 241 SPLAQGGKGVFDQKVIRDLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAEN
18 -> 261 LGLGVWQASNEEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVNREELFITTKLWNDDHKRPREALLDSLKKLQLDYIDLYLMHWPVPAIDHYVEAWKGMIELQKEGLIKSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDELGEIAKLD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.23 - methylglyoxal metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0004032 - alditol:NADP+ 1-oxidoreductase activity
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0050580 - 2,5-didehydrogluconate reductase activity
GO:0008106 - alcohol dehydrogenase (NADP+) activity
biological_process GO:0051596 - methylglyoxal catabolic process
GO:0019853 - L-ascorbic acid biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-148
ECOLIWIKI:
b3012
INTERPRO:
IPR036812
INTERPRO:
IPR023210
INTERPRO:
IPR020471
INTERPRO:
IPR018170
MODBASE:
Q46857
PANTHER:
PTHR43827
PDB:
1MZR
PFAM:
PF00248
PRIDE:
Q46857
PRINTS:
PR00069
PRODB:
PRO_000022451
PROSITE:
PS00798
PROSITE:
PS00063
PROSITE:
PS00062
REFSEQ:
NP_417485
SMR:
Q46857
SWISSMODEL:
Q46857
UNIPROT:
Q46857


Operon      
Name: yqhD-dkgA         
Operon arrangement:
Transcription unit        Promoter
yqhD-dkgA
 


Transcriptional Regulation      
Display Regulation             
Activated by: YqhC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqhCp1 3155384 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3319 3156572 forward nd [RS-EPT-CBR] [2]
  promoter yqhHp4 3158421 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB