RegulonDB RegulonDB 11.0: Gene Form
   

yqjC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mzrA yqjC yqjD TSS_3404 TSS_3404 TSS_3403 (cluster) TSS_3403 (cluster) TSS_3402 (cluster) TSS_3402 (cluster) TSS_3401 TSS_3401

Gene      
Name: yqjC    Texpresso search in the literature
Synonym(s): ECK3088, G7611, b3097
Genome position(nucleotides): 3248969 --> 3249337
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.78
External database links:  
ASAP:
ABE-0010188
ECHOBASE:
EB2598
ECOLIHUB:
yqjC
OU-MICROARRAY:
b3097
STRING:
511145.b3097
COLOMBOS: yqjC


Product      
Name: DUF1090 domain-containing protein YqjC
Synonym(s): YqjC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.906
Isoelectric point: 9.092
Motif(s):
 
Type Positions Sequence Comment
1 -> 20 MKYRIALAVSLFALSAGSYA
10 -> 116 SLFALSAGSYATTLCQEKEQNILKEISYAEKHQNQNRIDGLNKALSEVRANCSDSQLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKIAKRERKLAEAQEELKK
21 -> 122 TTLCQEKEQNILKEISYAEKHQNQNRIDGLNKALSEVRANCSDSQLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKIAKRERKLAEAQEELKKLEARDY UniProt: Protein YqjC.
65 -> 100 QLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKI UniProt: Disordered; Sequence Annotation Type: region of interest.
92 -> 93 KQ UniProt: In Ref. 1; AAA57901..

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P42616
ECOCYC:
G7611-MONOMER
ECOLIWIKI:
b3097
INTERPRO:
IPR009468
PFAM:
PF06476
PRIDE:
P42616
REFSEQ:
NP_417568
UNIPROT:
P42616


Operon      
Name: yqjCDEK         
Operon arrangement:
Transcription unit        Promoter
yqjCDEK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3401 3248969 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3402 (cluster) 3249228 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3403 (cluster) 3249266 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3404 3249284 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB