RegulonDB RegulonDB 10.9: Gene Form
   

yqjF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqjG yqjF yqjK yqjE terminator yqjGp2 yqjGp2 yqjFp4 yqjFp4 yqjFp3 yqjFp3 yqjFp2 yqjFp2

Gene      
Name: yqjF    Texpresso search in the literature
Synonym(s): ECK3092, G7615, b3101
Genome position(nucleotides): 3250562 --> 3250954 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.85
External database links:  
ASAP:
ABE-0010200
ECHOBASE:
EB2601
ECOLIHUB:
yqjF
OU-MICROARRAY:
b3101
STRING:
511145.b3101
COLOMBOS: yqjF


Product      
Name: DoxX family protein
Synonym(s): YqjF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.102
Isoelectric point: 9.97
Motif(s):
 
Type Positions Sequence
8 -> 87 GVLVARILMPILFITAGWGKITGYAGTQQYMEAMGVPGFMLPLVILLEFGGGLAILFGFLTRTTALFTAGFTLLTAFLFH
6 -> 26 DVGVLVARILMPILFITAGWG
46 -> 66 FMLPLVILLEFGGGLAILFGF
71 -> 91 TALFTAGFTLLTAFLFHSNFA
102 -> 122 NLTISGGFLLLAITGPGAYSI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Yagur-Kroll S., et al., 2015
External database links:  
ECOCYC:
G7615-MONOMER
ECOLIWIKI:
b3101
INTERPRO:
IPR032808
PFAM:
PF07681
PRIDE:
P42619
REFSEQ:
NP_417572
UNIPROT:
P42619


Operon      
Name: yqjF         
Operon arrangement:
Transcription unit        Promoter
yqjF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqjFp2 3250466 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yqjFp3 3250472 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yqjFp4 3250475 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yqjGp2 3250974 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Yagur-Kroll S., Amiel E., Rosen R., Belkin S., 2015, Detection of 2,4-dinitrotoluene and 2,4,6-trinitrotoluene by an Escherichia coli bioreporter: performance enhancement by directed evolution., Appl Microbiol Biotechnol

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB