RegulonDB RegulonDB 11.0: Gene Form
   

cyuA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cyuP cyuA yhaL terminator

Gene      
Name: cyuA    Texpresso search in the literature
Synonym(s): ECK3099, G7622, b3108, b3109, b4470, yhaM, yhaN
Genome position(nucleotides): 3255341 <-- 3256651
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.9
External database links:  
ASAP:
ABE-0174100
ECHOBASE:
EB2608
ECOLIHUB:
yhaM
ECOO157CYC:
Z4462
OU-MICROARRAY:
b3108
STRING:
511145.b4470
COLOMBOS: cyuA


Product      
Name: putative L-cysteine desulfidase CyuA
Synonym(s): CyuA, YhaM, YhaN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.361
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence Comment
147 -> 428 GGHTNIVHIETHDGVVFTQQACVAEGEQESPLTVLSRTTLAEILKFVNEVPFAAIRFILDSAKLNCALSQEGLSGKWGLHIGATLEKQCERGLLAKDLSSSIVIRTSAASDARMGGATLPAMSNSGSGNQGITATMPVVVVAEHFGADDERLARALMLSHLSAIYIHNQLPRLSALCAATTAAMGAAAGMAWLVDGRYETISMAISSMIGDVSGMICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHDVEQSIANLCALASHSMQQTDRQII

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0080146 - L-cysteine desulfhydrase activity
biological_process GO:0009093 - cysteine catabolic process
GO:1901367 - response to L-cysteine
GO:0019450 - L-cysteine catabolic process to pyruvate
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P42626
ECOCYC:
G7622-MONOMER
ECOLIWIKI:
b4470
ECOO157CYC:
Z4462-MONOMER
INTERPRO:
IPR005130
INTERPRO:
IPR021144
PANTHER:
PTHR30501
PFAM:
PF03313
PRIDE:
P42626
REFSEQ:
YP_026202
UNIPROT:
P42626


Operon      
Name: cyuPA         
Operon arrangement:
Transcription unit        Promoter
cyuPA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB