RegulonDB RegulonDB 10.9: Gene Form
   

agaV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kbaZ agaS agaA agaV agaW AgaR AgaR AgaR AgaR AgaR AgaR agaSp agaSp

Gene      
Name: agaV    Texpresso search in the literature
Synonym(s): ECK3121, G7632, b3133, yhaY
Genome position(nucleotides): 3280217 --> 3280690 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.63
External database links:  
ASAP:
ABE-0010297
ECHOBASE:
EB2617
ECOLIHUB:
agaV
OU-MICROARRAY:
b3133
STRING:
511145.b3133
COLOMBOS: agaV


Product      
Name: N-acetyl-D-galactosamine specific PTS enzyme IIB component
Synonym(s): AgaV, EIIBAga, EIIBGalNAc, Enzyme IIBAga, Enzyme IIBGalNAc, YhaY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.086
Isoelectric point: 5.652
Motif(s):
 
Type Positions Sequence
4 -> 149 IVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDPVQQNLMEMVLAEGIAVRFWTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTVSVDAGDIAAFNDLKTAGVECFVQGVPTEP
1 -> 157 MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDPVQQNLMEMVLAEGIAVRFWTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTVSVDAGDIAAFNDLKTAGVECFVQGVPTEPAVDLFKLL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7632-MONOMER
ECOLIWIKI:
b3133
INTERPRO:
IPR004720
INTERPRO:
IPR018455
INTERPRO:
IPR036667
MODBASE:
P42904
PFAM:
PF03830
PRIDE:
P42904
PRODB:
PRO_000022068
PROSITE:
PS51101
REFSEQ:
NP_417602
SMR:
P42904
UNIPROT:
P42904


Operon      
Name: kbaZ-agaVWA         
Operon arrangement:
Transcription unit        Promoter
kbaZ-agaVWA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: AgaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB