RegulonDB RegulonDB 10.9: Gene Form
   

agaW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

agaS agaA agaV agaW AgaR AgaR AgaR AgaR AgaR AgaR agaSp agaSp

Gene      
Name: agaW    Texpresso search in the literature
Synonym(s): ECK3122, G7633, b3134, yhaZ
Type: Pseudo Gene
Genome position(nucleotides): 3280701 --> 3281102 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.21
External database links:  
ASAP:
ABE-0010299
ECHOBASE:
EB2618
ECOLIHUB:
agaW
ECOO157CYC:
Z4486
OU-MICROARRAY:
b3134
COLOMBOS: agaW


Product      
Name: N-acetyl-D-galactosamine specific PTS truncated enzyme IIC component
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
1 -> 133 MEISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAPLAGAQPPNVIIGTIVGTAFAITTGVKPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDLATNPRRI
3 -> 23 ISLLQAFALGIIAFIAGLDMF
66 -> 86 LAGAQPPNVIIGTIVGTAFAI
94 -> 114 VAVGVAVPFAVAVQMGITFLF
33 -> 53 VVLGPLVGLVLGDLHTGILTG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Reizer J., et al., 1996
External database links:  
ECOCYC:
G7633-MONOMER
ECOLIWIKI:
b3134
ECOO157CYC:
Z4486-MONOMER
INTERPRO:
IPR004700
PANTHER:
PTHR32502:SF4
PFAM:
PF03609
PRIDE:
P42905
PROSITE:
PS51106
REFSEQ:
NP_417603
UNIPROT:
P42905


Operon      
Name: kbaZ-agaVWA         
Operon arrangement:
Transcription unit        Promoter
kbaZ-agaVWA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: AgaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Reizer J., Ramseier TM., Reizer A., Charbit A., Saier MH., 1996, Novel phosphotransferase genes revealed by bacterial genome sequencing: a gene cluster encoding a putative N-acetylgalactosamine metabolic pathway in Escherichia coli., Microbiology 142 ( Pt 2):231-50


RegulonDB