RegulonDB RegulonDB 10.8: Gene Form
   

yraN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lpoA rsmI diaA yraN yraPp yraPp yraPp2 yraPp2 TSS_3418 TSS_3418 TSS_3417 TSS_3417 TSS_3416 TSS_3416 TSS_3415 TSS_3415 rsmIp8 rsmIp8 rsmIp6 rsmIp6 TSS_3414 TSS_3414 TSS_3413 TSS_3413 lpoAp2 lpoAp2

Gene      
Name: yraN    Texpresso search in the literature
Synonym(s): ECK3136, G7643, b3148
Genome position(nucleotides): 3295394 --> 3295789 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.55
External database links:  
ASAP:
ABE-0010346
ECHOBASE:
EB2632
OU-MICROARRAY:
b3148
PortEco:
yraN
STRING:
511145.b3148
COLOMBOS: yraN


Product      
Name: UPF0102 family protein YraN
Synonym(s): YraN
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 14.798
Isoelectric point: 10.438
Motif(s):
 
Type Positions Sequence
24 -> 114 EAQARRWLEGKGLRFIAANVNERGGEIDLIMREGRTTIFVEVRYRRSALYGGAAASVTRSKQHKLLQTARLWLARHNGSFDTVDCRFDVVA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0004518 - nuclease activity
biological_process GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12898N
ECOCYC:
G7643-MONOMER
ECOLIWIKI:
b3148
INTERPRO:
IPR011335
INTERPRO:
IPR003509
INTERPRO:
IPR011856
MINT:
MINT-1244192
PANTHER:
PTHR34039
PFAM:
PF02021
PRIDE:
P45465
REFSEQ:
NP_417617
SMR:
P45465
UNIPROT:
P45465


Operon      
Name: yraN         
Operon arrangement:
Transcription unit        Promoter
yraN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter lpoAp2 3293211 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3413 3293213 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3414 3293369 forward nd [RS-EPT-CBR] [2]
  promoter rsmIp6 3293393 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rsmIp8 3293553 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3415 3295433 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3416 3295436 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3417 3295444 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3418 3295942 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB