RegulonDB RegulonDB 10.8: Gene Form
   

yraP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yraQ diaA yraP yraPp yraPp yraPp2 yraPp2 TSS_3418 TSS_3418

Gene      
Name: yraP    Texpresso search in the literature
Synonym(s): ECK3138, G7644, b3150, ecfH
Genome position(nucleotides): 3296409 --> 3296984 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.34
External database links:  
ASAP:
ABE-0010350
ECHOBASE:
EB2634
OU-MICROARRAY:
b3150
PortEco:
yraP
STRING:
511145.b3150
COLOMBOS: yraP


Product      
Name: divisome-associated lipoprotein YraP
Synonym(s): EcfH, YraP
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,outer membrane
Molecular weight: 20.028
Isoelectric point: 9.56
Motif(s):
 
Type Positions Sequence
124 -> 191 NDTWITTKVRSQLLTSDLVKSSNVKVTTENGEVFLMGLVTEREAKAAADIASRVSGVKRVTTAFTFIK
24 -> 191 VVGTAAVGTKAATDPRSVGTQVDDGTLEVRVNSALSKDEQIKKEARINVTAYQGKVLLVGQSPNAELSARAKQIAMGVDGANEVYNEIRQGQPIGLGEASNDTWITTKVRSQLLTSDLVKSSNVKVTTENGEVFLMGLVTEREAKAAADIASRVSGVKRVTTAFTFIK
1 -> 23 MKALSPIAVLISALLLQGCVAAA
46 -> 115 DDGTLEVRVNSALSKDEQIKKEARINVTAYQGKVLLVGQSPNAELSARAKQIAMGVDGANEVYNEIRQGQ

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0032153 - cell division site
biological_process GO:0006970 - response to osmotic stress
Note(s): Note(s): ...[more].
External database links:  
BIGG:
lpp
ECOCYC:
G7644-MONOMER
ECOLIWIKI:
b3150
INTERPRO:
IPR007055
INTERPRO:
IPR014004
PFAM:
PF04972
PRIDE:
P64596
PROSITE:
PS51257
PROSITE:
PS50914
REFSEQ:
NP_417619
SMART:
SM00749
SMR:
P64596
UNIPROT:
P64596


Operon      
Name: yraP         
Operon arrangement:
Transcription unit        Promoter
yraP
yraP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3418 3295942 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB