RegulonDB RegulonDB 10.8: Gene Form
   

yraQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yraQ yraR yraP anti-anti-terminator anti-terminator terminator yraQp4 yraQp4 yraQp3 yraQp3

Gene      
Name: yraQ    Texpresso search in the literature
Synonym(s): ECK3139, G7645, b3151
Genome position(nucleotides): 3297098 <-- 3298138 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.73
External database links:  
ASAP:
ABE-0010353
ECHOBASE:
EB2635
OU-MICROARRAY:
b3151
PortEco:
yraQ
STRING:
511145.b3151
COLOMBOS: yraQ


Product      
Name: permease family protein YraQ
Synonym(s): YraQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.257
Isoelectric point: 9.897
Motif(s):
 
Type Positions Sequence
71 -> 91 MIYFLAVWKAAVLGVILGSLI
73 -> 340 YFLAVWKAAVLGVILGSLIQVLIPRDWLLRTLGQSRFRGTLLGTLFSLPGMMCTCCAAPVAAGMRRQQVSMGGALAFWMGNPVLNPATLVFMGFVLGWGFAAIRLVAGLVMVLLIATLVQKWVRETPQTQAPVEIDIPEAQGGFFSRWGRALWTLFWSTIPVYILAVLVLGAARVWLFPHADGAVDNSLMWVVAMAVAGCLFVIPTAAEIPIVQTMMLAGMGTAPALALLMTLPAVSLPSLIMLRKAFPAKALWLTGAMVAVSGVIVG
12 -> 32 PIQWWKPALFFLVVIAGLWYV
113 -> 133 LLGTLFSLPGMMCTCCAAPVA
146 -> 166 ALAFWMGNPVLNPATLVFMGF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-12901N
ECOCYC:
G7645-MONOMER
ECOLIWIKI:
b3151
INTERPRO:
IPR005524
MINT:
MINT-1279227
PFAM:
PF03773
PRIDE:
P45468
REFSEQ:
NP_417620
UNIPROT:
P45468


Operon      
Name: yraQ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yraQp3 3298174 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yraQp4 3298207 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB