RegulonDB RegulonDB 10.8: Gene Form
   

yhbQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ubiT yhbS yhbP yhbQ yhbO terminator anti-terminator anti-anti-terminator TSS_3425 (cluster) TSS_3425 (cluster) TSS_3424 TSS_3424 TSS_3423 TSS_3423 TSS_3422 TSS_3422 TSS_3421 TSS_3421 yhbQp2 yhbQp2 TSS_3420 TSS_3420

Gene      
Name: yhbQ    Texpresso search in the literature
Synonym(s): ECK3143, G7649, b3155
Genome position(nucleotides): 3299966 --> 3300268 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.46
External database links:  
ASAP:
ABE-0010370
ECHOBASE:
EB2639
OU-MICROARRAY:
b3155
PortEco:
yhbQ
STRING:
511145.b3155
COLOMBOS: yhbQ


Product      
Name: DNA damage response nuclease YhbQ
Synonym(s): YhbQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.27
Isoelectric point: 10.394
Motif(s):
 
Type Positions Sequence
7 -> 7 Y
2 -> 77 TPWFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGELTLVFSAPVGDRSLALRAEYRVKQLTKRQKER
19 -> 19 G
4 -> 75 WFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGELTLVFSAPVGDRSLALRAEYRVKQLTKRQK
5 -> 5 F

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008296 - 3'-5'-exodeoxyribonuclease activity
GO:0004520 - endodeoxyribonuclease activity
biological_process GO:0006259 - DNA metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7649-MONOMER
ECOLIWIKI:
b3155
INTERPRO:
IPR000305
INTERPRO:
IPR035901
INTERPRO:
IPR022992
PFAM:
PF01541
PRIDE:
P45472
PROSITE:
PS50164
REFSEQ:
NP_417624
SMART:
SM00465
SMR:
P45472
SWISSMODEL:
P45472
UNIPROT:
P45472


Operon      
Name: yhbQ         
Operon arrangement:
Transcription unit        Promoter
yhbQ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3420 3299936 reverse nd [RS-EPT-CBR] [1]
  promoter yhbQp2 3299939 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3421 3300908 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3422 3300960 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3423 3300965 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3424 3300967 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3425 (cluster) 3301010 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB