RegulonDB RegulonDB 10.9: Gene Form
   

ubiT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ubiU ubiT yhbS yhbQ CsgD CsgD terminator TSS_3428 TSS_3428 yhbUp5 yhbUp5 ubiTp1 ubiTp1 yhbUp1 yhbUp1 TSS_3427 TSS_3427 ubiTp2 ubiTp2 yhbUp7 yhbUp7 TSS_3425 (cluster) TSS_3425 (cluster) TSS_3424 TSS_3424 TSS_3423 TSS_3423 TSS_3422 TSS_3422 TSS_3421 TSS_3421

Gene      
Name: ubiT    Texpresso search in the literature
Synonym(s): ECK3145, G7651, b3157, yhbT
Genome position(nucleotides): 3300752 <-- 3301276 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.81
External database links:  
ASAP:
ABE-0010375
ECHOBASE:
EB2641
ECOLIHUB:
yhbT
OU-MICROARRAY:
b3157
STRING:
511145.b3157
COLOMBOS: ubiT


Product      
Name: anaerobic ubiquinone biosynthesis accessory factor UbiT
Synonym(s): SCP2 domain-containing protein YhbT, UbiT, YhbT, putative lipid carrier protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.672
Isoelectric point: 4.851
Motif(s):
 
Type Positions Sequence
45 -> 133 LDDGELEFLEGRWLSIHVRDIDLQWFTSVVNGKLVVSQNAQADVSFSADASDLLMIAARKQDPDTLFFQRRLVIEGDTELGLYVKNLMD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006744 - ubiquinone biosynthetic process
GO:0032150 - ubiquinone biosynthetic process from chorismate
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Pelosi L., et al., 2019
External database links:  
ECOCYC:
G7651-MONOMER
ECOLIWIKI:
b3157
INTERPRO:
IPR039543
INTERPRO:
IPR036527
INTERPRO:
IPR016830
INTERPRO:
IPR003033
MODBASE:
P64599
PANTHER:
PTHR10094
PFAM:
PF02036
PRIDE:
P64599
REFSEQ:
NP_417626
SMR:
P64599
UNIPROT:
P64599


Operon      
Name: ubiT-yhbS         
Operon arrangement:
Transcription unit        Promoter
ubiT-yhbS
ubiT-yhbS


Transcriptional Regulation      
Display Regulation             
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3421 3300908 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3422 3300960 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3423 3300965 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3424 3300967 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3425 (cluster) 3301010 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter yhbUp7 3301279 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3427 3301317 reverse nd [RS-EPT-CBR] [2]
  promoter yhbUp1 3301329 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yhbUp5 3301437 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3428 3301439 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Pelosi L., Vo CD., Abby SS., Loiseau L., Rascalou B., Hajj Chehade M., Faivre B., Gousse M., Chenal C., Touati N., Binet L., Cornu D., Fyfe CD., Fontecave M., Barras F., Lombard M., Pierrel F., 2019, Ubiquinone Biosynthesis over the Entire O2 Range: Characterization of a Conserved O2 -Independent Pathway., MBio 10(4)

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB