RegulonDB RegulonDB 10.8: Gene Form
   

ubiV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhbW ubiU ubiV TSS_3430 (cluster) TSS_3430 (cluster) TSS_3429 TSS_3429

Gene      
Name: ubiV    Texpresso search in the literature
Synonym(s): ECK3147, G7653, b3159, yhbV
Genome position(nucleotides): 3302489 --> 3303367 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.97
External database links:  
ASAP:
ABE-0010382
ECHOBASE:
EB2643
OU-MICROARRAY:
b3159
PortEco:
yhbV
STRING:
511145.b3159
COLOMBOS: ubiV


Product      
Name: ubiquinone biosynthesis protein UbiV
Synonym(s): UbiV, YhbV, putative peptidase YhbV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.535
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
39 -> 39 C
92 -> 198 IEASDLGVVNMCAERKLPFVAGHALNCYNAVTLKILLKQGMMRWCMPVELSRDWLVNLLNQCDELGIRNQFEVEVLSYGHLPLAYSARCFTARSEDRPKDECETCCI
197 -> 197 C
193 -> 193 C
180 -> 180 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0006508 - proteolysis
GO:0006744 - ubiquinone biosynthetic process
GO:0032150 - ubiquinone biosynthetic process from chorismate
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Pelosi L., et al., 2019
External database links:  
DIP:
DIP-12269N
ECOCYC:
G7653-MONOMER
ECOLIWIKI:
b3159
INTERPRO:
IPR001539
MINT:
MINT-1294878
PFAM:
PF01136
PRIDE:
P45475
REFSEQ:
NP_417628
UNIPROT:
P45475


Operon      
Name: ubiUV         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3429 3303412 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3430 (cluster) 3303422 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pelosi L., Vo CD., Abby SS., Loiseau L., Rascalou B., Hajj Chehade M., Faivre B., Gousse M., Chenal C., Touati N., Binet L., Cornu D., Fyfe CD., Fontecave M., Barras F., Lombard M., Pierrel F., 2019, Ubiquinone Biosynthesis over the Entire O2 Range: Characterization of a Conserved O2 -Independent Pathway., MBio 10(4)

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB