RegulonDB RegulonDB 10.9: Gene Form
   

nanE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nanT nanK nanE yhcH yhcHp2 yhcHp2

Gene      
Name: nanE    Texpresso search in the literature
Synonym(s): ECK3212, G7677, b3223, yhcJ
Genome position(nucleotides): 3370347 <-- 3371036 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.26
External database links:  
ASAP:
ABE-0010575
ECHOBASE:
EB2667
ECOLIHUB:
nanE
OU-MICROARRAY:
b3223
STRING:
511145.b3223
COLOMBOS: nanE


Product      
Name: putative N-acetylmannosamine-6-phosphate epimerase
Synonym(s): NanE, YhcJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.074
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
35 -> 226 VAAMALAAEQAGAVAIRIEGVANLQATRAVVSVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAIDGTDRPRPVPVETLLARIHHHGLLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETPEEPDLALVKTLSDAGCRVIAEGRYNTPAQAADAMRHGAWAVTVGSAITRLEHICQWYNTAMKK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.12 - amino sugar conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009385 - N-acylmannosamine-6-phosphate 2-epimerase activity
GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0016857 - racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0047465 - N-acylglucosamine-6-phosphate 2-epimerase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006051 - N-acetylmannosamine metabolic process
GO:0006053 - N-acetylmannosamine catabolic process
GO:0019262 - N-acetylneuraminate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Rodionova IA., et al., 2018
External database links:  
DIP:
DIP-48021N
ECOCYC:
NANE-MONOMER
ECOLIWIKI:
b3223
INTERPRO:
IPR007260
INTERPRO:
IPR011060
INTERPRO:
IPR013785
MODBASE:
P0A761
PANTHER:
PTHR36204
PFAM:
PF04131
PRIDE:
P0A761
REFSEQ:
NP_417690
SMR:
P0A761
UNIPROT:
P0A761


Operon      
Name: nanATEK-yhcH         
Operon arrangement:
Transcription unit        Promoter
nanA
nanATEK-yhcH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: NanR, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhcHp2 3369562 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Rodionova IA., Goodacre N., Babu M., Emili A., Uetz P., Saier MH., 2018, The Nitrogen Regulatory PII Protein (GlnB) and N -Acetylglucosamine 6-Phosphate Epimerase (NanE) Allosterically Activate Glucosamine 6-Phosphate Deaminase (NagB) in Escherichia coli., J Bacteriol 200(5)

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB