RegulonDB RegulonDB 10.9: Gene Form
   

fkpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fkpA yheO slyX ppGpp anti-anti-terminator anti-terminator terminator TSS_3950 TSS_3950 fkpAp1 fkpAp1 TSS_3948 TSS_3948 fkpAp2 fkpAp2 TSS_3947 TSS_3947 TSS_3946 (cluster) TSS_3946 (cluster) slyXp4 slyXp4 TSS_3945 TSS_3945 TSS_3944 TSS_3944 yheOp2 yheOp2 yheOp1 yheOp1

Gene      
Name: fkpA    Texpresso search in the literature
Synonym(s): ECK3334, G7716, b3347, yzzS
Genome position(nucleotides): 3476607 <-- 3477419 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.22
External database links:  
ASAP:
ABE-0010938
ECHOBASE:
EB2737
ECOLIHUB:
fkpA
OU-MICROARRAY:
b3347
STRING:
511145.b3347
COLOMBOS: fkpA


Product      
Name: peptidyl-prolyl cis-trans isomerase FkpA
Synonym(s): FkpA, YzzS
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 28.882
Isoelectric point: 9.063
Motif(s):
 
Type Positions Sequence
159 -> 246 EAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELL
46 -> 152 QKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQV
26 -> 270 AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
1 -> 25 MKSLFKVTLLATTMAVALHAPITFA
164 -> 249 SDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
biological_process GO:0006457 - protein folding
GO:0042026 - protein refolding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-9625N
ECOCYC:
G7716-MONOMER
ECOLIWIKI:
b3347
INTERPRO:
IPR036944
INTERPRO:
IPR001179
INTERPRO:
IPR000774
MINT:
P45523
MODBASE:
P45523
PDB:
4QCC
PDB:
1Q6U
PDB:
1Q6I
PDB:
1Q6H
PFAM:
PF00254
PFAM:
PF01346
PRIDE:
P45523
PRODB:
PRO_000022633
PROSITE:
PS50059
REFSEQ:
NP_417806
SMR:
P45523
UNIPROT:
P45523


Operon      
Name: fkpA         
Operon arrangement:
Transcription unit        Promoter
fkpA
fkpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3944 3477222 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3945 3477356 reverse nd [RS-EPT-CBR] [1]
  promoter slyXp4 3477431 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3946 (cluster) 3477468 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3947 3477490 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3948 3477512 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3950 3477615 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB