RegulonDB RegulonDB 10.9: Gene Form
   

hofN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mrcA hofM hofN hofO hofP hofQ CRP CRP terminator TSS_3995 TSS_3995 hofMp hofMp mrcAp mrcAp

Gene      
Name: hofN    Texpresso search in the literature
Synonym(s): ECK3381, G7738, b3394, yrfC
Genome position(nucleotides): 3521433 <-- 3521972 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.37
External database links:  
ASAP:
ABE-0011077
ECHOBASE:
EB2760
ECOLIHUB:
hofN
OU-MICROARRAY:
b3394
STRING:
511145.b3394
COLOMBOS: hofN


Product      
Name: DNA utilization protein HofN
Synonym(s): HofN, YrfC, protein involved in utilization of DNA as a carbon source
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.796
Isoelectric point: 11.477
Motif(s):
 
Type Positions Sequence
99 -> 168 LEALAALLPEHAWLTTISWQQGTLEIKGLTTSITALNALETSLRQDASFHLNQRGATQQDAQGRWQFEYQ
19 -> 39 LRFWLLMFVAPLLLAVGITLI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0043683 - type IV pilus biogenesis
GO:0006308 - DNA catabolic process
GO:0015976 - carbon utilization
GO:0043107 - type IV pilus-dependent motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Palchevskiy V., et al., 2006
External database links:  
ECOCYC:
G7738-MONOMER
ECOLIWIKI:
b3394
INTERPRO:
IPR007813
PFAM:
PF05137
PRIDE:
P64634
REFSEQ:
NP_417853
UNIPROT:
P64634


Operon      
Name: hofMNOP         
Operon arrangement:
Transcription unit        Promoter
hofMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3995 3524342 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Palchevskiy V., Finkel SE., 2006, Escherichia coli Competence Gene Homologs Are Essential for Competitive Fitness and the Use of DNA as a Nutrient., J Bacteriol 188(11):3902-10

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB