RegulonDB RegulonDB 10.9: Gene Form
   

hslR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hslO yrfG hslR hslOp3 hslOp3 hslOp4 hslOp4 TSS_3998 (cluster) TSS_3998 (cluster) hslRp hslRp

Gene      
Name: hslR    Texpresso search in the literature
Synonym(s): ECK3387, G7743, b3400, hsp15, yrfH
Genome position(nucleotides): 3529348 --> 3529749 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.48
External database links:  
ASAP:
ABE-0011094
ECHOBASE:
EB2765
ECOLIHUB:
hslR
OU-MICROARRAY:
b3400
STRING:
511145.b3400
COLOMBOS: hslR


Product      
Name: heat shock protein Hsp15
Synonym(s): HslR, Hsp15, YrfH, heat shock protein Hsp15 involved in ribosome recycling
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.496
Isoelectric point: 10.613
Motif(s):
 
Type Positions Sequence
9 -> 53 VRLDKWLWAARFYKTRALAREMIEGGKVHYNGQRSKPSKIVELNA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0003727 - single-stranded RNA binding
GO:0043023 - ribosomal large subunit binding
biological_process GO:0009408 - response to heat
GO:0034605 - cellular response to heat
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IPI] Inferred from physical interaction
Reference(s): [1] Jiang L., et al., 2009
[2] Korber P., et al., 2000
External database links:  
DIP:
DIP-48014N
ECOCYC:
G7743-MONOMER
ECOLIWIKI:
b3400
INTERPRO:
IPR002942
INTERPRO:
IPR025708
INTERPRO:
IPR036986
MODBASE:
P0ACG8
PDB:
1DM9
PDB:
3BBU
PFAM:
PF01479
PRIDE:
P0ACG8
PRODB:
PRO_000022933
PROSITE:
PS50889
REFSEQ:
NP_417859
SMART:
SM00363
SMR:
P0ACG8
UNIPROT:
P0ACG8


Operon      
Name: yrfG-hslRO         
Operon arrangement:
Transcription unit        Promoter
hslR-hslO
yrfG-hslR
hslO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3998 (cluster) 3529665 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter hslOp4 3529672 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter hslOp3 3529733 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jiang L., Schaffitzel C., Bingel-Erlenmeyer R., Ban N., Korber P., Koning RI., de Geus DC., Plaisier JR., Abrahams JP., 2009, Recycling of aborted ribosomal 50S subunit-nascent chain-tRNA complexes by the heat shock protein Hsp15., J Mol Biol 386(5):1357-67

 [2] Korber P., Stahl JM., Nierhaus KH., Bardwell JC., 2000, Hsp15: a ribosome-associated heat shock protein., EMBO J 19(4):741-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB